BP919189
Clone id YMU001_000122_C05
Library
Length 340
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000122_C05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGGAAGGATGCTGGACGAGGCTTTGGGCTGGAACGTGACACTACCACTTAACAAGGTGCT
GTTGGTAAAGGATGCTGTTTCTGCTCCTGCCTCGTTCCTTCTTCTCTATCTTCTTCGTAA
GATCCTCGCTTCTCCCGAGTCCTTCGTCATCTTCGTTGGCCTCAAGGAGCCTTTCTCTCA
CTACACTAAGATTGCAAGGAAACAGGGATGCAATTTGTTGGCACATCAAGATGGTGGCTC
TTTTGTGTACATAGACTTGTTGTCAAAAACAATCCTTCAGCTTTCAGATTGGACAACAAA
TGACACAGCTACAAGTGTGGAAAACAAACTTTTCCTACTT
■■Homology search results ■■ -
sp_hit_id Q0P424
Definition sp|Q0P424|CC075_DANRE UPF0405 protein C3orf75 homolog OS=Danio rerio
Align length 64
Score (bit) 36.2
E-value 0.052
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919189|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_C05.
(340 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q0P424|CC075_DANRE UPF0405 protein C3orf75 homolog OS=Danio r... 36 0.052
sp|Q9DGG6|ADCY9_CHICK Adenylate cyclase type 9 OS=Gallus gallus ... 32 0.75
sp|Q5UPG1|YL085_MIMIV Putative BTB/POZ domain-containing protein... 30 4.9
sp|Q8WKE7|MATK_FAGJA Maturase K OS=Fagus japonica GN=matK PE=3 SV=1 30 4.9
sp|Q8WKE6|MATK_FAGHA Maturase K OS=Fagus hayatae GN=matK PE=3 SV=1 30 4.9
sp|Q8W8E6|MATK_FAGCR Maturase K OS=Fagus crenata GN=matK PE=3 SV=2 30 4.9
sp|Q03157|APLP1_MOUSE Amyloid-like protein 1 OS=Mus musculus GN=... 29 6.4
sp|P01938|HBA_LORTA Hemoglobin subunit alpha OS=Loris tardigradu... 29 8.4
sp|P13916|GLCA_SOYBN Beta-conglycinin, alpha chain OS=Glycine ma... 29 8.4

>sp|Q0P424|CC075_DANRE UPF0405 protein C3orf75 homolog OS=Danio
rerio GN=tmem103 PE=2 SV=2
Length = 264

Score = 36.2 bits (82), Expect = 0.052
Identities = 21/64 (32%), Positives = 37/64 (57%)
Frame = +2

Query: 83 APASFLLLYLLRKILASPESFVIFVGLKEPFSHYTKIARKQGCNLLAHQDGGSFVYIDLL 262
A ASFL+ + L L + V F+GL + FSHY+ + ++ G +L ++ G V+++ L
Sbjct: 29 ADASFLIHHYLSFYLRAGCK-VCFLGLVQSFSHYSAVGQRLGVSLTQAREKGQLVFLEGL 87

Query: 263 SKTI 274
+I
Sbjct: 88 KDSI 91


>sp|Q9DGG6|ADCY9_CHICK Adenylate cyclase type 9 OS=Gallus gallus
GN=ADCY9 PE=2 SV=1
Length = 1334

Score = 32.3 bits (72), Expect = 0.75
Identities = 21/61 (34%), Positives = 29/61 (47%)
Frame = +2

Query: 101 LLYLLRKILASPESFVIFVGLKEPFSHYTKIARKQGCNLLAHQDGGSFVYIDLLSKTILQ 280
+L LL ++ P +F+GL T R + C LL GG VY +LLSK L
Sbjct: 222 VLLLLYTVMHLPLYLSLFLGLSYSVLFETSAFRDESCTLL----GGGAVYWELLSKAFLH 277

Query: 281 L 283
+
Sbjct: 278 V 278


>sp|Q5UPG1|YL085_MIMIV Putative BTB/POZ domain-containing protein
L85 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_L85 PE=3
SV=1
Length = 419

Score = 29.6 bits (65), Expect = 4.9
Identities = 14/41 (34%), Positives = 23/41 (56%)
Frame = +2

Query: 155 VGLKEPFSHYTKIARKQGCNLLAHQDGGSFVYIDLLSKTIL 277
+ L +PF H T I Q +++A DG +F I++L T +
Sbjct: 199 IKLDKPFHHTTNIVCSQNESIIAISDGQTFGLINVLKNTCI 239


>sp|Q8WKE7|MATK_FAGJA Maturase K OS=Fagus japonica GN=matK PE=3 SV=1
Length = 504

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 5/57 (8%)
Frame = +2

Query: 77 VSAPASFLLLYLLRKILASPESF-----VIFVGLKEPFSHYTKIARKQGCNLLAHQD 232
+S+ F LYL +KI E F VI LK+PF HY R QG ++LA +D
Sbjct: 235 ISSGVLFERLYLHKKIEHFAEVFANDFPVIPCFLKDPFMHY---VRYQGKSILASKD 288


>sp|Q8WKE6|MATK_FAGHA Maturase K OS=Fagus hayatae GN=matK PE=3 SV=1
Length = 504

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 5/57 (8%)
Frame = +2

Query: 77 VSAPASFLLLYLLRKILASPESF-----VIFVGLKEPFSHYTKIARKQGCNLLAHQD 232
+S+ F LYL +KI E F VI LK+PF HY R QG ++LA +D
Sbjct: 235 ISSGVLFERLYLHKKIEHFAEVFANDFPVIPCFLKDPFMHY---VRYQGKSILASKD 288


>sp|Q8W8E6|MATK_FAGCR Maturase K OS=Fagus crenata GN=matK PE=3 SV=2
Length = 504

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/57 (40%), Positives = 30/57 (52%), Gaps = 5/57 (8%)
Frame = +2

Query: 77 VSAPASFLLLYLLRKILASPESF-----VIFVGLKEPFSHYTKIARKQGCNLLAHQD 232
+S+ F LYL +KI E F VI LK+PF HY R QG ++LA +D
Sbjct: 235 ISSGVLFERLYLHKKIEHFAEVFANDFPVIPCFLKDPFMHY---VRYQGKSILASKD 288


>sp|Q03157|APLP1_MOUSE Amyloid-like protein 1 OS=Mus musculus
GN=Aplp1 PE=1 SV=1
Length = 653

Score = 29.3 bits (64), Expect = 6.4
Identities = 13/31 (41%), Positives = 21/31 (67%)
Frame = -3

Query: 104 EEGTRQEQKQHPLPTAPC*VVVSRSSPKPRP 12
EE +E+++ P P++ V+VSR +P PRP
Sbjct: 263 EEEEEEEEERAPPPSSHTPVMVSRVTPTPRP 293


>sp|P01938|HBA_LORTA Hemoglobin subunit alpha OS=Loris tardigradus
GN=HBA PE=1 SV=2
Length = 141

Score = 28.9 bits (63), Expect = 8.4
Identities = 15/39 (38%), Positives = 21/39 (53%)
Frame = -3

Query: 332 KVCFPHL*LCHLLSNLKAEGLFLTTSLCTQKSHHLDVPT 216
K FPH L H + +KA G + +L T SH D+P+
Sbjct: 40 KTYFPHFDLSHGSAQVKAHGKKVADALTTAVSHVDDMPS 78


>sp|P13916|GLCA_SOYBN Beta-conglycinin, alpha chain OS=Glycine max
PE=2 SV=2
Length = 605

Score = 28.9 bits (63), Expect = 8.4
Identities = 11/24 (45%), Positives = 15/24 (62%)
Frame = -3

Query: 125 GSYEEDREEGTRQEQKQHPLPTAP 54
GS EED +E Q+++Q P P P
Sbjct: 136 GSEEEDEDEDEEQDERQFPFPRPP 159


tr_hit_id A9TYB6
Definition tr|A9TYB6|A9TYB6_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 98
Score (bit) 76.6
E-value 6.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919189|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_C05.
(340 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TYB6|A9TYB6_PHYPA Predicted protein OS=Physcomitrella paten... 77 6e-13
tr|Q8L9Y2|Q8L9Y2_ARATH Putative uncharacterized protein (Putativ... 73 8e-12
tr|Q9SN32|Q9SN32_ARATH Putative uncharacterized protein F28M11.1... 70 4e-11
tr|A5AHS6|A5AHS6_VITVI Putative uncharacterized protein OS=Vitis... 69 9e-11
tr|A7Q403|A7Q403_VITVI Chromosome chr13 scaffold_48, whole genom... 69 1e-10
tr|B8ALI9|B8ALI9_ORYSI Putative uncharacterized protein OS=Oryza... 58 2e-07
tr|B6U129|B6U129_MAIZE Putative uncharacterized protein OS=Zea m... 58 2e-07
tr|B4G1P0|B4G1P0_MAIZE Putative uncharacterized protein OS=Zea m... 58 2e-07
tr|A3AGR3|A3AGR3_ORYSJ Putative uncharacterized protein OS=Oryza... 55 2e-06
tr|Q8H8T6|Q8H8T6_ORYSJ Putative uncharacterized protein (Express... 45 0.002
tr|Q0DSW5|Q0DSW5_ORYSJ Os03g0284000 protein OS=Oryza sativa subs... 45 0.002
tr|B8A3C1|B8A3C1_MAIZE Putative uncharacterized protein OS=Zea m... 44 0.003
tr|A7SNY5|A7SNY5_NEMVE Predicted protein (Fragment) OS=Nematoste... 40 0.045
tr|Q8JJW4|Q8JJW4_9CLOS Viral HSP70 homologue OS=Sweet potato chl... 38 0.29
tr|B3SA08|B3SA08_TRIAD Putative uncharacterized protein OS=Trich... 38 0.29
tr|Q16LJ7|Q16LJ7_AEDAE Putative uncharacterized protein OS=Aedes... 34 3.2
tr|Q3U311|Q3U311_MOUSE Putative uncharacterized protein OS=Mus m... 33 9.3

>tr|A9TYB6|A9TYB6_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_152588 PE=4 SV=1
Length = 266

Score = 76.6 bits (187), Expect = 6e-13
Identities = 44/98 (44%), Positives = 63/98 (64%), Gaps = 12/98 (12%)
Frame = +2

Query: 8 MLDEALGWNVT-LPLNKVLLVKDAVSAPASFLLLYLLRKILASPE----SF----VIFVG 160
ML+EAL W LP ++L++D V+A FLL ++L+K+L S SF V+FV
Sbjct: 1 MLEEALDWKGDGLPPGALILIEDCVAAKGGFLLTFMLKKLLTSSAHGDGSFARTRVVFVA 60

Query: 161 LKEPFSHYTKIARKQ---GCNLLAHQDGGSFVYIDLLS 265
+ EPFSHY +IA+KQ GCNLL +D G V++DL++
Sbjct: 61 MAEPFSHYGRIAKKQVRVGCNLLHCRDNGQLVFLDLMA 98


>tr|Q8L9Y2|Q8L9Y2_ARATH Putative uncharacterized protein (Putative
uncharacterized protein At4g10090) (At4g10090)
OS=Arabidopsis thaliana GN=At4g10090 PE=2 SV=1
Length = 262

Score = 72.8 bits (177), Expect = 8e-12
Identities = 45/115 (39%), Positives = 67/115 (58%), Gaps = 6/115 (5%)
Frame = +2

Query: 8 MLDEALGWNVTL----PLN-KVLLVKDAVSAPASFLLLYLLRKILASPES-FVIFVGLKE 169
+LD ALG++ L PLN KV+L++D V SF+L L++++L+S S +IF+
Sbjct: 7 LLDLALGFDEQLAIPSPLNGKVILIEDCVETSGSFVLHQLMKRVLSSNSSDALIFLAFAR 66

Query: 170 PFSHYTKIARKQGCNLLAHQDGGSFVYIDLLSKTILQLSDWTTNDTATSVENKLF 334
PFSHY +I RK GCNL H+ V+ D+L +++ SD + S KLF
Sbjct: 67 PFSHYDRILRKLGCNLATHKSNNRLVFFDML---MVKCSDGDQMEDNVSAVAKLF 118


>tr|Q9SN32|Q9SN32_ARATH Putative uncharacterized protein F28M11.10
(Putative uncharacterized protein AT4g10090)
OS=Arabidopsis thaliana GN=F28M11.10 PE=2 SV=1
Length = 253

Score = 70.5 bits (171), Expect = 4e-11
Identities = 39/91 (42%), Positives = 57/91 (62%), Gaps = 6/91 (6%)
Frame = +2

Query: 8 MLDEALGWNVTL----PLN-KVLLVKDAVSAPASFLLLYLLRKILASPES-FVIFVGLKE 169
+LD ALG++ L PLN KV+L++D V SF+L L++++L+S S +IF+
Sbjct: 7 LLDLALGFDEQLAIPSPLNGKVILIEDCVETSGSFVLHQLMKRVLSSNSSDALIFLAFAR 66

Query: 170 PFSHYTKIARKQGCNLLAHQDGGSFVYIDLL 262
PFSHY +I RK GCNL H+ V+ D+L
Sbjct: 67 PFSHYDRILRKLGCNLATHKSNNRLVFFDML 97


>tr|A5AHS6|A5AHS6_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007890 PE=4 SV=1
Length = 321

Score = 69.3 bits (168), Expect = 9e-11
Identities = 37/89 (41%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
Frame = +2

Query: 8 MLDEALGWNVTLPLNKVLLVKDAVSAPASFLLLYLLRKILA---SPESFVIFVGLKEPFS 178
+LDEAL + T P +V++++D V +F+L ++L++ LA S S VIF+ +PFS
Sbjct: 9 LLDEALALDWTQP--RVIVIEDCVETNGAFVLHHVLKRCLALHTSSTSAVIFLAFSQPFS 66

Query: 179 HYTKIARKQGCNLLAHQDGGSFVYIDLLS 265
HY +I RK GCNL+ +D FV+ +LL+
Sbjct: 67 HYDRILRKLGCNLVTPKDNKRFVFFNLLT 95


>tr|A7Q403|A7Q403_VITVI Chromosome chr13 scaffold_48, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00029487001
PE=4 SV=1
Length = 256

Score = 68.9 bits (167), Expect = 1e-10
Identities = 37/89 (41%), Positives = 58/89 (65%), Gaps = 3/89 (3%)
Frame = +2

Query: 8 MLDEALGWNVTLPLNKVLLVKDAVSAPASFLLLYLLRKILA---SPESFVIFVGLKEPFS 178
+LDEAL + T P +V++++D V +F+L ++L++ LA S S VIF+ +PFS
Sbjct: 9 LLDEALALDWTQP--RVIVIEDCVETNGAFVLHHVLKRSLALHTSSTSAVIFLAFSQPFS 66

Query: 179 HYTKIARKQGCNLLAHQDGGSFVYIDLLS 265
HY +I RK GCNL+ +D FV+ +LL+
Sbjct: 67 HYDRILRKLGCNLVTPKDNKRFVFFNLLT 95


>tr|B8ALI9|B8ALI9_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11060 PE=4 SV=1
Length = 236

Score = 58.2 bits (139), Expect = 2e-07
Identities = 31/80 (38%), Positives = 48/80 (60%)
Frame = +2

Query: 2 GRMLDEALGWNVTLPLNKVLLVKDAVSAPASFLLLYLLRKILASPESFVIFVGLKEPFSH 181
G +L EA+G +V++V+D V AP +F L LL++ LA + + + L +PFSH
Sbjct: 7 GDLLSEAMGSGA-----RVVVVEDRVEAPGAFALHLLLKRALAGGGAAAL-LALAQPFSH 60

Query: 182 YTKIARKQGCNLLAHQDGGS 241
Y ++ RK GCNL H+ G+
Sbjct: 61 YDRVLRKMGCNLSLHRKSGA 80


>tr|B6U129|B6U129_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 275

Score = 58.2 bits (139), Expect = 2e-07
Identities = 29/70 (41%), Positives = 44/70 (62%)
Frame = +2

Query: 53 KVLLVKDAVSAPASFLLLYLLRKILASPESFVIFVGLKEPFSHYTKIARKQGCNLLAHQD 232
+V++V+D V AP +F+L LL++ LA S F+ L +PFSHY ++ RK GCNL H+
Sbjct: 19 QVVVVEDCVEAPGAFVLHLLLKRALAGCGS-AAFLALAQPFSHYDRVLRKMGCNLSLHRR 77

Query: 233 GGSFVYIDLL 262
+ +LL
Sbjct: 78 NERLHFFELL 87


>tr|B4G1P0|B4G1P0_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 249

Score = 58.2 bits (139), Expect = 2e-07
Identities = 29/70 (41%), Positives = 44/70 (62%)
Frame = +2

Query: 53 KVLLVKDAVSAPASFLLLYLLRKILASPESFVIFVGLKEPFSHYTKIARKQGCNLLAHQD 232
+V++V+D V AP +F+L LL++ LA S F+ L +PFSHY ++ RK GCNL H+
Sbjct: 19 QVVVVEDCVEAPGAFVLHLLLKRALAGCGS-AAFLALAQPFSHYDRVLRKMGCNLSLHRR 77

Query: 233 GGSFVYIDLL 262
+ +LL
Sbjct: 78 NERLHFFELL 87


>tr|A3AGR3|A3AGR3_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009985 PE=4 SV=1
Length = 198

Score = 55.1 bits (131), Expect = 2e-06
Identities = 26/63 (41%), Positives = 41/63 (65%)
Frame = +2

Query: 53 KVLLVKDAVSAPASFLLLYLLRKILASPESFVIFVGLKEPFSHYTKIARKQGCNLLAHQD 232
+V++V+D V AP +F L LL++ LA + + + L +PFSHY ++ RK GCNL H+
Sbjct: 6 RVVVVEDRVEAPGAFALHLLLKRALAGGGAAAL-LALAQPFSHYDRVLRKMGCNLSLHRK 64

Query: 233 GGS 241
G+
Sbjct: 65 SGA 67


>tr|Q8H8T6|Q8H8T6_ORYSJ Putative uncharacterized protein (Expressed
protein) OS=Oryza sativa subsp. japonica
GN=LOC_Os03g17560 PE=4 SV=1
Length = 256

Score = 44.7 bits (104), Expect = 0.002
Identities = 31/109 (28%), Positives = 52/109 (47%)
Frame = +2

Query: 2 GRMLDEALGWNVTLPLNKVLLVKDAVSAPASFLLLYLLRKILASPESFVIFVGLKEPFSH 181
G +L EA+G +V++V+D V AP +F L LL++ LA + + + L +PFSH
Sbjct: 7 GDLLSEAMGSGA-----RVVVVEDRVEAPGAFALHLLLKRALAGGGAAAL-LALAQPFSH 60

Query: 182 YTKIARKQGCNLLAHQDGGSFVYIDLLSKTILQLSDWTTNDTATSVENK 328
Y ++ RK F ++L +L W ++ SV +
Sbjct: 61 YDRVLRKM-----------IFNAVELTHLLVLIKDGWEKQNSTPSVSQR 98