BP919220
Clone id YMU001_000122_F01
Library
Length 344
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000122_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTTTTTTTCAAACGGTATAATTTTACTTCACATATTTCAAATAATGTCAAAG
AATTCAATCCTCATGAATTTCTCGAGTACCCAAAGATGACCTTATTTACATATAATGTAC
AGTATTGTCGATAGCAATCAGAAGTTTCATCTACATAACCGACTCTACACCCAGATGTCA
GATGTGCAGTCCCCGCCCGGATAGCGCACCTCATGGGCAAGGGCAGGCCCACCTGGCTCC
TTTCCAAAATCTACAAAAAAGTTCTCATTGATAGACAAGCCTCCTTTTTCTGTATCACAG
TCAATTTGCAGCATATACGATCCTTGCGCAACAAGTCCAGGATA
■■Homology search results ■■ -
sp_hit_id Q569D5
Definition sp|Q569D5|SBP1_XENTR Selenium-binding protein 1 OS=Xenopus tropicalis
Align length 59
Score (bit) 105.0
E-value 5.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919220|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_F01.
(328 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q569D5|SBP1_XENTR Selenium-binding protein 1 OS=Xenopus tropi... 105 5e-23
sp|Q52KZ7|SBP1A_XENLA Selenium-binding protein 1-A OS=Xenopus la... 102 6e-22
sp|O23264|SBP_ARATH Putative selenium-binding protein OS=Arabido... 101 1e-21
sp|Q5RF48|SBP1_PONAB Selenium-binding protein 1 OS=Pongo abelii ... 100 2e-21
sp|Q13228|SBP1_HUMAN Selenium-binding protein 1 OS=Homo sapiens ... 100 2e-21
sp|Q6DCH7|SBP1B_XENLA Selenium-binding protein 1-B OS=Xenopus la... 100 2e-21
sp|Q8VIF7|SBP1_RAT Selenium-binding protein 1 OS=Rattus norvegic... 100 3e-21
sp|P17563|SBP1_MOUSE Selenium-binding protein 1 OS=Mus musculus ... 99 5e-21
sp|Q6PHD9|SBP1_DANRE Selenium-binding protein 1 OS=Danio rerio G... 99 5e-21
sp|Q2KJ32|SBP1_BOVIN Selenium-binding protein 1 OS=Bos taurus GN... 99 5e-21
sp|Q63836|SBP2_MOUSE Selenium-binding protein 2 OS=Mus musculus ... 99 7e-21
sp|Q90404|AGRIN_DISOM Agrin (Fragment) OS=Discopyge ommata GN=AG... 32 1.3
sp|Q8F483|RL28_LEPIN 50S ribosomal protein L28 OS=Leptospira int... 29 6.5
sp|Q72RI5|RL28_LEPIC 50S ribosomal protein L28 OS=Leptospira int... 29 6.5
sp|Q051S9|RL28_LEPBL 50S ribosomal protein L28 OS=Leptospira bor... 29 6.5
sp|Q04RU2|RL28_LEPBJ 50S ribosomal protein L28 OS=Leptospira bor... 29 6.5
sp|Q96D15|RCN3_HUMAN Reticulocalbin-3 OS=Homo sapiens GN=RCN3 PE... 29 8.4

>sp|Q569D5|SBP1_XENTR Selenium-binding protein 1 OS=Xenopus
tropicalis GN=selenbp1 PE=2 SV=1
Length = 472

Score = 105 bits (263), Expect = 5e-23
Identities = 45/59 (76%), Positives = 51/59 (86%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP ++ +GS MLQID DTEKGGL +N NF VDFGKEPGGP LAHE+RYPGGDC+SDIWV
Sbjct: 414 YPDMIKEGSVMLQIDVDTEKGGLKLNPNFLVDFGKEPGGPVLAHELRYPGGDCSSDIWV 472


>sp|Q52KZ7|SBP1A_XENLA Selenium-binding protein 1-A OS=Xenopus
laevis GN=selenbp1-A PE=2 SV=1
Length = 472

Score = 102 bits (254), Expect = 6e-22
Identities = 43/59 (72%), Positives = 50/59 (84%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +G+ MLQID DT+KGGL +N NF VDFGKEP GP LAHE+RYPGGDCTSDIW+
Sbjct: 414 YPDLLKEGAVMLQIDVDTKKGGLKLNPNFLVDFGKEPDGPVLAHEIRYPGGDCTSDIWI 472


>sp|O23264|SBP_ARATH Putative selenium-binding protein
OS=Arabidopsis thaliana GN=At4g14030 PE=2 SV=1
Length = 490

Score = 101 bits (251), Expect = 1e-21
Identities = 42/59 (71%), Positives = 53/59 (89%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP ++ +GS+++QID DTEKGGL+IN +FFVDFG EP GP+LAHE+RYPGGDCTSDIW+
Sbjct: 432 YPEIMEKGSHIIQIDVDTEKGGLTINPDFFVDFGDEPDGPSLAHEMRYPGGDCTSDIWI 490


>sp|Q5RF48|SBP1_PONAB Selenium-binding protein 1 OS=Pongo abelii
GN=SELENBP1 PE=2 SV=1
Length = 472

Score = 100 bits (250), Expect = 2e-21
Identities = 43/59 (72%), Positives = 50/59 (84%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS MLQ+D DT KGGL +N NF VDFGKEP GPALAHE+RYPGGDC+SDIW+
Sbjct: 414 YPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI 472


>sp|Q13228|SBP1_HUMAN Selenium-binding protein 1 OS=Homo sapiens
GN=SELENBP1 PE=1 SV=2
Length = 472

Score = 100 bits (250), Expect = 2e-21
Identities = 43/59 (72%), Positives = 50/59 (84%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS MLQ+D DT KGGL +N NF VDFGKEP GPALAHE+RYPGGDC+SDIW+
Sbjct: 414 YPDLIREGSVMLQVDVDTVKGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI 472


>sp|Q6DCH7|SBP1B_XENLA Selenium-binding protein 1-B OS=Xenopus
laevis GN=selenbp1-B PE=2 SV=1
Length = 472

Score = 100 bits (250), Expect = 2e-21
Identities = 42/59 (71%), Positives = 50/59 (84%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP ++ +G+ MLQID DTEKGGL +N NF VDFGKEP GP LAHE+RYPGGDC+SDIW+
Sbjct: 414 YPDMLKEGAVMLQIDVDTEKGGLKLNPNFLVDFGKEPDGPVLAHELRYPGGDCSSDIWI 472


>sp|Q8VIF7|SBP1_RAT Selenium-binding protein 1 OS=Rattus norvegicus
GN=Selenbp1 PE=1 SV=1
Length = 472

Score = 100 bits (248), Expect = 3e-21
Identities = 43/59 (72%), Positives = 49/59 (83%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS MLQID DT GGL +N NF VDFGKEP GPALAHE+RYPGGDC+SDIW+
Sbjct: 414 YPNLIREGSVMLQIDVDTANGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI 472


>sp|P17563|SBP1_MOUSE Selenium-binding protein 1 OS=Mus musculus
GN=Selenbp1 PE=1 SV=2
Length = 472

Score = 99.4 bits (246), Expect = 5e-21
Identities = 43/59 (72%), Positives = 49/59 (83%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS MLQID DT GGL +N NF VDFGKEP GPALAHE+RYPGGDC+SDIW+
Sbjct: 414 YPDLIREGSMMLQIDVDTVNGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWI 472


>sp|Q6PHD9|SBP1_DANRE Selenium-binding protein 1 OS=Danio rerio
GN=selenbp1 PE=2 SV=1
Length = 457

Score = 99.4 bits (246), Expect = 5e-21
Identities = 42/59 (71%), Positives = 50/59 (84%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS M+QID +T+ GGL +NENF VDFG EP GPALAHE+RYPGGDCTSDIW+
Sbjct: 399 YPDLIKEGSVMMQIDVNTDTGGLKLNENFLVDFGAEPEGPALAHELRYPGGDCTSDIWL 457


>sp|Q2KJ32|SBP1_BOVIN Selenium-binding protein 1 OS=Bos taurus
GN=SELENBP1 PE=1 SV=1
Length = 472

Score = 99.4 bits (246), Expect = 5e-21
Identities = 43/59 (72%), Positives = 50/59 (84%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS MLQID DT +GGL +N NF VDFGKEP GPALAHE+RYPGGDC+SDIW+
Sbjct: 414 YPDLIREGSVMLQIDVDTVRGGLKLNPNFLVDFGKEPLGPALAHELRYPGGDCSSDIWL 472


tr_hit_id Q93VA1
Definition tr|Q93VA1|Q93VA1_LOTJA Selenium binding protein OS=Lotus japonicus
Align length 59
Score (bit) 109.0
E-value 6.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919220|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_F01.
(328 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q93VA1|Q93VA1_LOTJA Selenium binding protein OS=Lotus japonic... 109 6e-23
tr|Q93YH7|Q93YH7_SOYBN Selenium binding protein (Fragment) OS=Gl... 108 1e-22
tr|A9P1N8|A9P1N8_PICSI Putative uncharacterized protein OS=Picea... 108 1e-22
tr|Q9LK38|Q9LK38_ARATH Selenium-binding protein OS=Arabidopsis t... 107 2e-22
tr|Q28CY4|Q28CY4_XENTR Selenium binding protein 1 OS=Xenopus tro... 105 8e-22
tr|Q8S2S4|Q8S2S4_THEHA Putative selenium-binding protein OS=Thel... 105 1e-21
tr|A7Q737|A7Q737_VITVI Chromosome chr5 scaffold_58, whole genome... 105 1e-21
tr|A5ARG7|A5ARG7_VITVI Putative uncharacterized protein OS=Vitis... 105 1e-21
tr|Q93WS1|Q93WS1_MEDSA Selenium binding protein OS=Medicago sati... 105 1e-21
tr|B7FJ17|B7FJ17_MEDTR Putative uncharacterized protein OS=Medic... 105 1e-21
tr|B7NZD6|B7NZD6_RABIT Selenium binding protein 1 (Predicted) OS... 104 2e-21
tr|A4UU24|A4UU24_9AVES Selenium binding protein 1 OS=Anser anser... 103 3e-21
tr|Q9AVA6|Q9AVA6_ORYSA Putative selenium binding protein OS=Oryz... 103 4e-21
tr|Q8RZW7|Q8RZW7_ORYSJ Putative selenium binding protein (Putati... 103 4e-21
tr|B7ZXK5|B7ZXK5_MAIZE Putative uncharacterized protein OS=Zea m... 103 4e-21
tr|B6TFC2|B6TFC2_MAIZE Selenium-binding protein OS=Zea mays PE=2... 103 4e-21
tr|B4FAL8|B4FAL8_MAIZE Putative uncharacterized protein OS=Zea m... 103 4e-21
tr|A6N020|A6N020_ORYSI Selenium binding protein (Fragment) OS=Or... 103 4e-21
tr|A2WYB3|A2WYB3_ORYSI Putative uncharacterized protein OS=Oryza... 103 4e-21
tr|Q677E8|Q677E8_HYAOR Selenium-binding protein (Fragment) OS=Hy... 102 1e-20
tr|B4UT06|B4UT06_OTOGA Selenium binding protein 1 (Predicted) OS... 101 2e-20
tr|B5X2U7|B5X2U7_SALSA Selenium-binding protein 1 OS=Salmo salar... 100 3e-20
tr|A9RIT9|A9RIT9_PHYPA Predicted protein OS=Physcomitrella paten... 100 3e-20
tr|B2KI67|B2KI67_RHIFE Selenium-binding protein 1 (Predicted) OS... 100 3e-20
tr|B2KI66|B2KI66_RHIFE Selenium binding protein 1 (Predicted) OS... 100 3e-20
tr|B0KWC4|B0KWC4_CALJA Selenium binding protein 1 (Predicted) OS... 100 3e-20
tr|A9X1A2|A9X1A2_PAPAN Selenium binding protein 1 (Predicted) OS... 100 3e-20
tr|Q49AQ8|Q49AQ8_HUMAN SELENBP1 protein OS=Homo sapiens GN=SELEN... 100 3e-20
tr|B4E1F3|B4E1F3_HUMAN cDNA FLJ61035, highly similar to Selenium... 100 3e-20
tr|B4DPI7|B4DPI7_HUMAN cDNA FLJ52715, highly similar to Selenium... 100 3e-20

>tr|Q93VA1|Q93VA1_LOTJA Selenium binding protein OS=Lotus japonicus
GN=sbp PE=2 SV=1
Length = 487

Score = 109 bits (273), Expect = 6e-23
Identities = 48/59 (81%), Positives = 53/59 (89%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YPGLV +GS++LQID DTEKGGL IN NFFVDFG EP GPALAHE+RYPGGDCTSDIW+
Sbjct: 429 YPGLVEKGSHILQIDVDTEKGGLKINPNFFVDFGAEPDGPALAHEMRYPGGDCTSDIWI 487


>tr|Q93YH7|Q93YH7_SOYBN Selenium binding protein (Fragment)
OS=Glycine max GN=sbp PE=2 SV=1
Length = 478

Score = 108 bits (271), Expect = 1e-22
Identities = 48/59 (81%), Positives = 52/59 (88%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP LV +GS+MLQID DTE GGL IN NFFVDFG EPGGPALAHE+RYPGGDCTSDIW+
Sbjct: 420 YPELVEKGSHMLQIDVDTENGGLKINPNFFVDFGAEPGGPALAHEMRYPGGDCTSDIWI 478


>tr|A9P1N8|A9P1N8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 199

Score = 108 bits (270), Expect = 1e-22
Identities = 47/59 (79%), Positives = 53/59 (89%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS+MLQIDCDTEKGGL++N NFFVDF EP GPALAHE+RYPGGDCTSDIWV
Sbjct: 141 YPELIEKGSHMLQIDCDTEKGGLAVNANFFVDFETEPEGPALAHEMRYPGGDCTSDIWV 199


>tr|Q9LK38|Q9LK38_ARATH Selenium-binding protein OS=Arabidopsis
thaliana GN=At3g23800/MYM9_14 PE=2 SV=1
Length = 480

Score = 107 bits (268), Expect = 2e-22
Identities = 48/59 (81%), Positives = 53/59 (89%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP LV +GS+MLQID DT+KGGLSIN NFFVDFG EP GP+LAHE+RYPGGDCTSDIWV
Sbjct: 422 YPELVEKGSHMLQIDVDTDKGGLSINPNFFVDFGTEPDGPSLAHEMRYPGGDCTSDIWV 480


>tr|Q28CY4|Q28CY4_XENTR Selenium binding protein 1 OS=Xenopus
tropicalis GN=selenbp1 PE=2 SV=1
Length = 409

Score = 105 bits (263), Expect = 8e-22
Identities = 45/59 (76%), Positives = 51/59 (86%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP ++ +GS MLQID DTEKGGL +N NF VDFGKEPGGP LAHE+RYPGGDC+SDIWV
Sbjct: 351 YPDMIKEGSVMLQIDVDTEKGGLKLNPNFLVDFGKEPGGPVLAHELRYPGGDCSSDIWV 409


>tr|Q8S2S4|Q8S2S4_THEHA Putative selenium-binding protein
OS=Thellungiella halophila PE=2 SV=1
Length = 409

Score = 105 bits (262), Expect = 1e-21
Identities = 46/59 (77%), Positives = 53/59 (89%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L+ +GS+++QID DTEKGGLSIN NFFVDFG EP GPALAHE+RYPGGDCTSDIW+
Sbjct: 351 YPELMDKGSHIIQIDVDTEKGGLSINPNFFVDFGDEPEGPALAHEMRYPGGDCTSDIWI 409


>tr|A7Q737|A7Q737_VITVI Chromosome chr5 scaffold_58, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031667001
PE=4 SV=1
Length = 473

Score = 105 bits (262), Expect = 1e-21
Identities = 47/59 (79%), Positives = 51/59 (86%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L +GS+MLQID DTEKGGL IN NFFVDFG EP GP+LAHE+RYPGGDCTSDIWV
Sbjct: 415 YPDLPREGSHMLQIDVDTEKGGLVINPNFFVDFGSEPDGPSLAHEMRYPGGDCTSDIWV 473


>tr|A5ARG7|A5ARG7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_043460 PE=4 SV=1
Length = 95

Score = 105 bits (262), Expect = 1e-21
Identities = 47/59 (79%), Positives = 51/59 (86%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP L +GS+MLQID DTEKGGL IN NFFVDFG EP GP+LAHE+RYPGGDCTSDIWV
Sbjct: 37 YPDLPREGSHMLQIDVDTEKGGLVINPNFFVDFGSEPDGPSLAHEMRYPGGDCTSDIWV 95


>tr|Q93WS1|Q93WS1_MEDSA Selenium binding protein OS=Medicago sativa
GN=sbp PE=2 SV=1
Length = 488

Score = 105 bits (261), Expect = 1e-21
Identities = 46/59 (77%), Positives = 51/59 (86%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP LV QGS++LQID DTE GGL IN NFFVDFG EP GP+LAHE+RYPGGDCTSDIW+
Sbjct: 430 YPKLVEQGSHILQIDVDTENGGLKINPNFFVDFGAEPDGPSLAHEMRYPGGDCTSDIWI 488


>tr|B7FJ17|B7FJ17_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 488

Score = 105 bits (261), Expect = 1e-21
Identities = 46/59 (77%), Positives = 51/59 (86%)
Frame = -1

Query: 328 YPGLVAQGSYMLQIDCDTEKGGLSINENFFVDFGKEPGGPALAHEVRYPGGDCTSDIWV 152
YP LV QGS++LQID DTE GGL IN NFFVDFG EP GP+LAHE+RYPGGDCTSDIW+
Sbjct: 430 YPKLVEQGSHILQIDVDTENGGLKINPNFFVDFGAEPDGPSLAHEMRYPGGDCTSDIWI 488