BP919242
Clone id YMU001_000122_G11
Library
Length 568
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000122_G11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAATACATCCTGTGCTTCTACAACTGAGCCACACTTAGCATAGCAATCCACAAGAACAC
TTCCAACATACAGATCAATTTTGTATCCCTCTTTTAATATCTCGGCGTGCAAATGTTGGA
CTCTATCAACTTGTCTTGAGCTGCCACATGCATTCAAGCTGCATGCATACATGACAGCAT
CTAGACACAGACCCTCTGATTGCATCGTTTCTAGCAGGTTAAGAGCTTCCTCATCAAACC
CATAATCTACATAACCTGCCATCAAAGCAGTCCATGCAACTAAAGCTGGGGTGGACGTCC
TGTCAAAAACAAACCTTGCTTCTGCAAGTGAGCCACATTTGGCATACATGTCTACTAGAC
TGCTGATGATACAAGGATCGGCATCAAAGCCTGCTCTAACTAGCTCTCCATGCAAATGCA
AACCTTCATTCAGGGCACTCGATCTGCTACATGATCTCAGAGCCTCTATGTACGAGACGG
CATTTGGAGCAACACCCTGCAATTGCATTTCACTCAGACACTTAATACCATGTTCTGCAC
AACCTTTGTCAGCATATCCTGTAATAAG
■■Homology search results ■■ -
sp_hit_id Q9LTV8
Definition sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein At3g12770 OS=Arabidopsis thaliana
Align length 184
Score (bit) 116.0
E-value 8.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919242|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_G11.
(555 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 116 8e-26
sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protei... 115 1e-25
sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protei... 115 2e-25
sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protei... 112 2e-24
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 111 2e-24
sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containi... 111 2e-24
sp|Q9MA85|PP215_ARATH Pentatricopeptide repeat-containing protei... 111 3e-24
sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protei... 110 4e-24
sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protei... 110 4e-24
sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protei... 110 6e-24
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 109 1e-23
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 108 1e-23
sp|O65543|PP343_ARATH Pentatricopeptide repeat-containing protei... 108 1e-23
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 108 2e-23
sp|Q9LYU9|PP378_ARATH Pentatricopeptide repeat-containing protei... 106 9e-23
sp|Q9LUJ2|PP249_ARATH Pentatricopeptide repeat-containing protei... 105 1e-22
sp|Q9SVA5|PP357_ARATH Pentatricopeptide repeat-containing protei... 105 2e-22
sp|P0C898|PP232_ARATH Putative pentatricopeptide repeat-containi... 104 3e-22
sp|Q9LW63|PP251_ARATH Putative pentatricopeptide repeat-containi... 104 3e-22
sp|Q9FM64|PP431_ARATH Pentatricopeptide repeat-containing protei... 103 6e-22
sp|Q9ZUW3|PP172_ARATH Pentatricopeptide repeat-containing protei... 103 6e-22
sp|Q0WSH6|PP312_ARATH Pentatricopeptide repeat-containing protei... 102 1e-21
sp|Q9LTF4|PP429_ARATH Putative pentatricopeptide repeat-containi... 102 2e-21
sp|Q9FLX6|PP430_ARATH Pentatricopeptide repeat-containing protei... 101 2e-21
sp|Q9XE98|PP303_ARATH Pentatricopeptide repeat-containing protei... 101 3e-21
sp|Q3E6Q1|PPR32_ARATH Pentatricopeptide repeat-containing protei... 100 4e-21
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 100 6e-21
sp|Q9LZ19|PP364_ARATH Pentatricopeptide repeat-containing protei... 100 8e-21
sp|Q9FXB9|PPR84_ARATH Pentatricopeptide repeat-containing protei... 99 1e-20
sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containi... 99 1e-20

>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein
At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1
Length = 694

Score = 116 bits (290), Expect = 8e-26
Identities = 53/184 (28%), Positives = 105/184 (57%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G ++ S+M+ V P+ V+ + L + + L +G +H +V+ G + +P
Sbjct: 198 AQNGEPMEALEIFSQMRKMDVKPDWVALVSVLNAFTCLQDLKQGRSIHASVVKMGLEIEP 257

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
++ SL MYAKCG +A A+ +FD+ +P L+ W A+++GY G+ EA+++ M ++
Sbjct: 258 DLLISLNTMYAKCGQVATAKILFDKMKSPNLILWNAMISGYAKNGYAREAIDMFHEMINK 317

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
+ D + +++AC +++ + ++ + + Y+ D+++ S L+D +AKCGSV A
Sbjct: 318 DVRPDTISITSAISACAQVGSLEQARSMYEYVGRSDYRDDVFISSALIDMFAKCGSVEGA 377

Query: 13 QDVF 2
+ VF
Sbjct: 378 RLVF 381



Score = 100 bits (250), Expect = 4e-21
Identities = 59/173 (34%), Positives = 94/173 (54%), Gaps = 2/173 (1%)
Frame = -3

Query: 514 SEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKC 335
S MQL V+P++ ++ L++CS S L G +H ++ R GFDAD + + L+ +YAKC
Sbjct: 108 SNMQLARVSPDSFTFPHLLKACSGLSHLQMGRFVHAQVFRLGFDADVFVQNGLIALYAKC 167

Query: 334 GSLAEARFVFDRTSTP--ALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYAC 161
L AR VF+ P +V+WTA+++ Y G EAL + M+ + D V
Sbjct: 168 RRLGSARTVFEGLPLPERTIVSWTAIVSAYAQNGEPMEALEIFSQMRKMDVKPDWVALVS 227

Query: 160 SLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
LNA + + + + +HA ++K G +I+ + L YAKCG V A+ +F
Sbjct: 228 VLNAFTCLQDLKQGRSIHASVVKMGLEIEPDLLISLNTMYAKCGQVATAKILF 280



Score = 85.1 bits (209), Expect = 2e-16
Identities = 48/142 (33%), Positives = 77/142 (54%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G A I EM + V P+ +S A+ +C++ +L + ++ + R+ + D
Sbjct: 299 AKNGYAREAIDMFHEMINKDVRPDTISITSAISACAQVGSLEQARSMYEYVGRSDYRDDV 358

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
I S+L+DM+AKCGS+ AR VFDRT +V W+A++ GY +G EA++L M+
Sbjct: 359 FISSALIDMFAKCGSVEGARLVFDRTLDRDVVVWSAMIVGYGLHGRAREAISLYRAMERG 418

Query: 193 GLCLDAVMYACSLNACGSSRQV 128
G+ + V + L AC S V
Sbjct: 419 GVHPNDVTFLGLLMACNHSGMV 440



Score = 68.9 bits (167), Expect = 2e-11
Identities = 40/157 (25%), Positives = 73/157 (46%)
Frame = -3

Query: 472 YIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFVFDRTS 293
Y + S + + L + +H L+ G +I+ L+ + G + AR VFD
Sbjct: 24 YASLIDSATHKAQLKQ---IHARLLVLGLQFSGFLITKLIHASSSFGDITFARQVFDDLP 80

Query: 292 TPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQH 113
P + W A++ GY ++AL + MQ + D+ + L AC + +
Sbjct: 81 RPQIFPWNAIIRGYSRNNHFQDALLMYSNMQLARVSPDSFTFPHLLKACSGLSHLQMGRF 140

Query: 112 LHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+HA++ + G+ D++V + L+ YAKC + A+ VF
Sbjct: 141 VHAQVFRLGFDADVFVQNGLIALYAKCRRLGSARTVF 177


>sp|O04659|PP398_ARATH Pentatricopeptide repeat-containing protein
At5g27110 OS=Arabidopsis thaliana GN=PCMP-E14 PE=2 SV=2
Length = 691

Score = 115 bits (288), Expect = 1e-25
Identities = 63/181 (34%), Positives = 92/181 (50%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G AE ++ M+ G PN+VS A+ +CSR L G +H + V+ GF+ D +
Sbjct: 187 GEAEKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKEIHRKCVKKGFELDEYVN 246

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
S+LVDMY KC L AR VF + +LVAW +++ GYV G + + +L M EG
Sbjct: 247 SALVDMYGKCDCLEVAREVFQKMPRKSLVAWNSMIKGYVAKGDSKSCVEILNRMIIEGTR 306

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
L AC SR + + +H +++ D+YV L+D Y KCG A+ V
Sbjct: 307 PSQTTLTSILMACSRSRNLLHGKFIHGYVIRSVVNADIYVNCSLIDLYFKCGEANLAETV 366

Query: 4 F 2
F
Sbjct: 367 F 367



Score = 101 bits (251), Expect = 3e-21
Identities = 54/182 (29%), Positives = 96/182 (52%)
Frame = -3

Query: 547 KGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCI 368
KG ++ ++ L+ M ++G P+ + L +CSRS L G +HG ++R+ +AD +
Sbjct: 287 KGDSKSCVEILNRMIIEGTRPSQTTLTSILMACSRSRNLLHGKFIHGYVIRSVVNADIYV 346

Query: 367 ISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGL 188
SL+D+Y KCG A VF +T +W +++ Y+ G +A+ + + M S G+
Sbjct: 347 NCSLIDLYFKCGEANLAETVFSKTQKDVAESWNVMISSYISVGNWFKAVEVYDQMVSVGV 406

Query: 187 CLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQD 8
D V + L AC +++ + +H I + + D + S L+D Y+KCG+ EA
Sbjct: 407 KPDVVTFTSVLPACSQLAALEKGKQIHLSISESRLETDELLLSALLDMYSKCGNEKEAFR 466

Query: 7 VF 2
+F
Sbjct: 467 IF 468



Score = 92.0 bits (227), Expect = 2e-18
Identities = 50/176 (28%), Positives = 95/176 (53%), Gaps = 2/176 (1%)
Frame = -3

Query: 526 IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDM 347
++ +M GV P+ V++ L +CS+ +AL +G +H + + + D ++S+L+DM
Sbjct: 395 VEVYDQMVSVGVKPDVVTFTSVLPACSQLAALEKGKQIHLSISESRLETDELLLSALLDM 454

Query: 346 YAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMY 167
Y+KCG+ EA +F+ +V+WT +++ Y +G EAL + MQ GL D V
Sbjct: 455 YSKCGNEKEAFRIFNSIPKKDVVSWTVMISAYGSHGQPREALYQFDEMQKFGLKPDGVTL 514

Query: 166 ACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVG--SVLVDCYAKCGSVVEAQDV 5
L+ACG + +D ++ ++ Y I+ + S ++D + G ++EA ++
Sbjct: 515 LAVLSACGHAGLIDEGLKFFSQ-MRSKYGIEPIIEHYSCMIDILGRAGRLLEAYEI 569



Score = 86.3 bits (212), Expect = 9e-17
Identities = 45/141 (31%), Positives = 78/141 (55%)
Frame = -3

Query: 424 GLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVD 245
G +H +V++G+ D + SSLV MYAK + VFD + +W +++ +
Sbjct: 126 GRMIHTLVVKSGYVCDVVVASSLVGMYAKFNLFENSLQVFDEMPERDVASWNTVISCFYQ 185

Query: 244 YGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYV 65
G E+AL L M+S G ++V +++AC ++R + +H + +K+G+++D YV
Sbjct: 186 SGEAEKALELFGRMESSGFEPNSVSLTVAISACSRLLWLERGKEIHRKCVKKGFELDEYV 245

Query: 64 GSVLVDCYAKCGSVVEAQDVF 2
S LVD Y KC + A++VF
Sbjct: 246 NSALVDMYGKCDCLEVAREVF 266



Score = 58.5 bits (140), Expect = 2e-08
Identities = 41/159 (25%), Positives = 73/159 (45%), Gaps = 3/159 (1%)
Frame = -3

Query: 469 IEALRSCSRSSALNEGLHL-HGELVRAGFDADPCIISSLVDMYAKCGSLAEARFVFDRTS 293
+ LR C+ S+ + L H ++ G D + SL+++Y C AR VF+
Sbjct: 7 LSLLRECTNSTKSLRRIKLVHQRILTLGLRRDVVLCKSLINVYFTCKDHCSARHVFENFD 66

Query: 292 TPALV-AWTALMAGYVDYGFDEEALNLLETMQSEGLCL-DAVMYACSLNACGSSRQVDRV 119
+ V W +LM+GY + L + + + + +C+ D+ + + A G+ +
Sbjct: 67 IRSDVYIWNSLMSGYSKNSMFHDTLEVFKRLLNCSICVPDSFTFPNVIKAYGALGREFLG 126

Query: 118 QHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ +H ++K GY D+ V S LV YAK + VF
Sbjct: 127 RMIHTLVVKSGYVCDVVVASSLVGMYAKFNLFENSLQVF 165


>sp|Q9SN39|PP320_ARATH Pentatricopeptide repeat-containing protein
At4g18750, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H45 PE=2 SV=1
Length = 871

Score = 115 bits (287), Expect = 2e-25
Identities = 60/181 (33%), Positives = 98/181 (54%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G AE G+ +M + G+ + + + C+ S ++ G +H V+A F +
Sbjct: 275 GLAEKGLSVFVQMLVSGIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRFC 334

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
++L+DMY+KCG L A+ VF S ++V++T+++AGY G EA+ L E M+ EG+
Sbjct: 335 NTLLDMYSKCGDLDSAKAVFREMSDRSVVSYTSMIAGYAREGLAGEAVKLFEEMEEEGIS 394

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
D LN C R +D + +H I + D++V + L+D YAKCGS+ EA+ V
Sbjct: 395 PDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDIFVSNALMDMYAKCGSMQEAELV 454

Query: 4 F 2
F
Sbjct: 455 F 455



Score = 114 bits (285), Expect = 3e-25
Identities = 60/185 (32%), Positives = 98/185 (52%), Gaps = 1/185 (0%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A +G A +K EM+ +G++P+ + L C+R L+EG +H + D
Sbjct: 373 AREGLAGEAVKLFEEMEEEGISPDVYTVTAVLNCCARYRLLDEGKRVHEWIKENDLGFDI 432

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLE-TMQS 197
+ ++L+DMYAKCGS+ EA VF +++W ++ GY + EAL+L ++
Sbjct: 433 FVSNALMDMYAKCGSMQEAELVFSEMRVKDIISWNTIIGGYSKNCYANEALSLFNLLLEE 492

Query: 196 EGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVE 17
+ D AC L AC S D+ + +H I++ GY D +V + LVD YAKCG+++
Sbjct: 493 KRFSPDERTVACVLPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKCGALLL 552

Query: 16 AQDVF 2
A +F
Sbjct: 553 AHMLF 557



Score = 96.3 bits (238), Expect = 9e-20
Identities = 54/151 (35%), Positives = 88/151 (58%), Gaps = 2/151 (1%)
Frame = -3

Query: 460 LRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFVFDRTSTPAL 281
L +C+ SA ++G +HG ++R G+ +D + +SLVDMYAKCG+L A +FD ++ L
Sbjct: 506 LPACASLSAFDKGREIHGYIMRNGYFSDRHVANSLVDMYAKCGALLLAHMLFDDIASKDL 565

Query: 280 VAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAE 101
V+WT ++AGY +GF +EA+ L M+ G+ D + + L AC S VD
Sbjct: 566 VSWTVMIAGYGMHGFGKEAIALFNQMRQAGIEADEISFVSLLYACSHSGLVDEGWRFF-N 624

Query: 100 ILKEGYKIDLYVG--SVLVDCYAKCGSVVEA 14
I++ KI+ V + +VD A+ G +++A
Sbjct: 625 IMRHECKIEPTVEHYACIVDMLARTGDLIKA 655



Score = 76.6 bits (187), Expect = 7e-14
Identities = 48/184 (26%), Positives = 88/184 (47%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G I +M GV ++ ++ +S S +++ G LHG ++++GF
Sbjct: 171 AKSGDFSGSIGLFKKMMSSGVEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERN 230

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ +SLV Y K + AR VFD + +++W +++ GYV G E+ L++ M
Sbjct: 231 SVGNSLVAFYLKNQRVDSARKVFDEMTERDVISWNSIINGYVSNGLAEKGLSVFVQMLVS 290

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ +D C SR + + +H+ +K + + + L+D Y+KCG + A
Sbjct: 291 GIEIDLATIVSVFAGCADSRLISLGRAVHSIGVKACFSREDRFCNTLLDMYSKCGDLDSA 350

Query: 13 QDVF 2
+ VF
Sbjct: 351 KAVF 354



Score = 74.7 bits (182), Expect = 3e-13
Identities = 54/183 (29%), Positives = 81/183 (44%)
Frame = -3

Query: 550 DKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPC 371
+ G E+ +K L + P + + L+ C+ S +L +G + + GF D
Sbjct: 73 ESGNLENAVKLLCVSGKWDIDPRTLCSV--LQLCADSKSLKDGKEVDNFIRGNGFVIDSN 130

Query: 370 IISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEG 191
+ S L MY CG L EA VFD + W LM G ++ L + M S G
Sbjct: 131 LGSKLSLMYTNCGDLKEASRVFDEVKIEKALFWNILMNELAKSGDFSGSIGLFKKMMSSG 190

Query: 190 LCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQ 11
+ +D+ ++C + S R V + LH ILK G+ VG+ LV Y K V A+
Sbjct: 191 VEMDSYTFSCVSKSFSSLRSVHGGEQLHGFILKSGFGERNSVGNSLVAFYLKNQRVDSAR 250

Query: 10 DVF 2
VF
Sbjct: 251 KVF 253



Score = 45.1 bits (105), Expect = 2e-04
Identities = 36/161 (22%), Positives = 72/161 (44%), Gaps = 6/161 (3%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCI- 368
G + I ++M+ G+ + +S++ L +CS S ++EG ++R +P +
Sbjct: 579 GFGKEAIALFNQMRQAGIEADEISFVSLLYACSHSGLVDEGWRFF-NIMRHECKIEPTVE 637

Query: 367 -ISSLVDMYAKCGSLAEA-RFVFDRTSTPALVAWTALMAG---YVDYGFDEEALNLLETM 203
+ +VDM A+ G L +A RF+ + P W AL+ G + D E+ + +
Sbjct: 638 HYACIVDMLARTGDLIKAYRFIENMPIPPDATIWGALLCGCRIHHDVKLAEKVAEKVFEL 697

Query: 202 QSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYK 80
+ E + Y N + + ++V+ L I + G +
Sbjct: 698 EPE----NTGYYVLMANIYAEAEKWEQVKRLRKRIGQRGLR 734


>sp|P93005|PP181_ARATH Pentatricopeptide repeat-containing protein
At2g33680 OS=Arabidopsis thaliana GN=PCMP-E19 PE=2 SV=1
Length = 727

Score = 112 bits (279), Expect = 2e-24
Identities = 62/184 (33%), Positives = 98/184 (53%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
+ G + +K S M G+ P+ + + L +CS L EG LH L++ GF+
Sbjct: 298 SQNGESLEAVKLFSRMFSAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHL 357

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
++LVDMYAK G LA+AR FD + WT+L++GYV +EEAL L M++
Sbjct: 358 FATTALVDMYAKAGCLADARKGFDCLQERDVALWTSLISGYVQNSDNEEALILYRRMKTA 417

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ + A L AC S ++ + +H +K G+ +++ +GS L Y+KCGS+ +
Sbjct: 418 GIIPNDPTMASVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSALSTMYSKCGSLEDG 477

Query: 13 QDVF 2
VF
Sbjct: 478 NLVF 481



Score = 92.0 bits (227), Expect = 2e-18
Identities = 55/179 (30%), Positives = 94/179 (52%), Gaps = 3/179 (1%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
E + M+ G+ PN + L++CS + L G +HG ++ GF + I S+L
Sbjct: 405 EEALILYRRMKTAGIIPNDPTMASVLKACSSLATLELGKQVHGHTIKHGFGLEVPIGSAL 464

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
MY+KCGSL + VF RT +V+W A+++G G +EAL L E M +EG+ D
Sbjct: 465 STMYSKCGSLEDGNLVFRRTPNKDVVSWNAMISGLSHNGQGDEALELFEEMLAEGMEPDD 524

Query: 175 VMYACSLNACGSSRQVDR---VQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQD 8
V + ++AC V+R ++ ++ + K+D Y + +VD ++ G + EA++
Sbjct: 525 VTFVNIISACSHKGFVERGWFYFNMMSDQIGLDPKVDHY--ACMVDLLSRAGQLKEAKE 581



Score = 79.3 bits (194), Expect = 1e-14
Identities = 53/186 (28%), Positives = 88/186 (47%), Gaps = 2/186 (1%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYI--EALRSCSRSSALNEGLHLHGELVRAGFDA 380
A +G E IK + + + Y+ L S + + + G +H ++ G
Sbjct: 195 ATRGRVEEAIKVFNLFLREKEEGSDSDYVFTAVLSSLAATIYVGLGRQIHCITIKNGLLG 254

Query: 379 DPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQ 200
+ ++LV MY+KC SL EA +FD + + W+A++ GY G EA+ L M
Sbjct: 255 FVALSNALVTMYSKCESLNEACKMFDSSGDRNSITWSAMVTGYSQNGESLEAVKLFSRMF 314

Query: 199 SEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVV 20
S G+ LNAC ++ + LH+ +LK G++ L+ + LVD YAK G +
Sbjct: 315 SAGIKPSEYTIVGVLNACSDICYLEEGKQLHSFLLKLGFERHLFATTALVDMYAKAGCLA 374

Query: 19 EAQDVF 2
+A+ F
Sbjct: 375 DARKGF 380



Score = 68.9 bits (167), Expect = 2e-11
Identities = 49/167 (29%), Positives = 80/167 (47%), Gaps = 5/167 (2%)
Frame = -3

Query: 487 PNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCI--ISSLVDMYAKCGSLAEAR 314
P+ + ++ L S+ L G +HG+++R G A CI + LV+ YAKCG LA+A
Sbjct: 12 PHTSTLLKKLTHHSQQRNLVAGRAVHGQIIRTG--ASTCIQHANVLVNFYAKCGKLAKAH 69

Query: 313 FVFDRTSTPALVAWTALMAGYVDYG---FDEEALNLLETMQSEGLCLDAVMYACSLNACG 143
+F+ +V+W +L+ GY G + L M+++ + +A A A
Sbjct: 70 SIFNAIICKDVVSWNSLITGYSQNGGISSSYTVMQLFREMRAQDILPNAYTLAGIFKAES 129

Query: 142 SSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
S + + HA ++K D+YV + LV Y K G V + VF
Sbjct: 130 SLQSSTVGRQAHALVVKMSSFGDIYVDTSLVGMYCKAGLVEDGLKVF 176



Score = 61.6 bits (148), Expect = 2e-09
Identities = 47/173 (27%), Positives = 79/173 (45%), Gaps = 3/173 (1%)
Frame = -3

Query: 511 EMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCG 332
EM+ Q + PNA + ++ S + G H +V+ D + +SLV MY K G
Sbjct: 108 EMRAQDILPNAYTLAGIFKAESSLQSSTVGRQAHALVVKMSSFGDIYVDTSLVGMYCKAG 167

Query: 331 SLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEAL---NLLETMQSEGLCLDAVMYAC 161
+ + VF W+ +++GY G EEA+ NL + EG D V +
Sbjct: 168 LVEDGLKVFAYMPERNTYTWSTMVSGYATRGRVEEAIKVFNLFLREKEEGSDSDYV-FTA 226

Query: 160 SLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
L++ ++ V + +H +K G + + + LV Y+KC S+ EA +F
Sbjct: 227 VLSSLAATIYVGLGRQIHCITIKNGLLGFVALSNALVTMYSKCESLNEACKMF 279


>sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protein
At4g18520 OS=Arabidopsis thaliana GN=PCMP-A2 PE=2 SV=1
Length = 617

Score = 111 bits (278), Expect = 2e-24
Identities = 64/180 (35%), Positives = 96/180 (53%), Gaps = 3/180 (1%)
Frame = -3

Query: 532 HGIKCLSE---MQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIIS 362
HGIK + M PN + L++CS AL G +H +V+ D + +
Sbjct: 264 HGIKAIGMFIGMLNHWFLPNEFTVCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGT 323

Query: 361 SLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCL 182
SL+DMYAKCG +++ R VFD S V WT+++A + GF EEA++L M+ L
Sbjct: 324 SLMDMYAKCGEISDCRKVFDGMSNRNTVTWTSIIAAHAREGFGEEAISLFRIMKRRHLIA 383

Query: 181 DAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ + L ACGS + + LHA+I+K + ++Y+GS LV Y KCG E++D F
Sbjct: 384 NNLTVVSILRACGSVGALLLGKELHAQIIKNSIEKNVYIGSTLVWLYCKCG---ESRDAF 440



Score = 99.8 bits (247), Expect = 8e-21
Identities = 58/184 (31%), Positives = 98/184 (53%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A +G E I M+ + + N ++ + LR+C AL G LH ++++ + +
Sbjct: 361 AREGFGEEAISLFRIMKRRHLIANNLTVVSILRACGSVGALLLGKELHAQIIKNSIEKNV 420

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
I S+LV +Y KCG +A V + + +V+WTA+++G G + EAL+ L+ M E
Sbjct: 421 YIGSTLVWLYCKCGESRDAFNVLQQLPSRDVVSWTAMISGCSSLGHESEALDFLKEMIQE 480

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ + Y+ +L AC +S + + +H+ K +++VGS L+ YAKCG V EA
Sbjct: 481 GVEPNPFTYSSALKACANSESLLIGRSIHSIAKKNHALSNVFVGSALIHMYAKCGFVSEA 540

Query: 13 QDVF 2
VF
Sbjct: 541 FRVF 544



Score = 89.7 bits (221), Expect = 8e-18
Identities = 51/139 (36%), Positives = 78/139 (56%), Gaps = 5/139 (3%)
Frame = -3

Query: 544 GCAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDA 380
GC+ G + L EM +GV PN +Y AL++C+ S +L G +H + +
Sbjct: 460 GCSSLGHESEALDFLKEMIQEGVEPNPFTYSSALKACANSESLLIGRSIHSIAKKNHALS 519

Query: 379 DPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQ 200
+ + S+L+ MYAKCG ++EA VFD LV+W A++ GY GF EAL L+ M+
Sbjct: 520 NVFVGSALIHMYAKCGFVSEAFRVFDSMPEKNLVSWKAMIMGYARNGFCREALKLMYRME 579

Query: 199 SEGLCLDAVMYACSLNACG 143
+EG +D ++A L+ CG
Sbjct: 580 AEGFEVDDYIFATILSTCG 598



Score = 82.8 bits (203), Expect = 1e-15
Identities = 49/178 (27%), Positives = 86/178 (48%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
+HGI+ +E ++ L CSR + G +HG +V+ G + + SSL
Sbjct: 176 KHGIRFTNERM----------FVCLLNLCSRRAEFELGRQVHGNMVKVGV-GNLIVESSL 224

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
V YA+CG L A FD +++WTA+++ G +A+ + M + +
Sbjct: 225 VYFYAQCGELTSALRAFDMMEEKDVISWTAVISACSRKGHGIKAIGMFIGMLNHWFLPNE 284

Query: 175 VMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
L AC + + + +H+ ++K K D++VG+ L+D YAKCG + + + VF
Sbjct: 285 FTVCSILKACSEEKALRFGRQVHSLVVKRMIKTDVFVGTSLMDMYAKCGEISDCRKVF 342



Score = 68.2 bits (165), Expect = 3e-11
Identities = 40/122 (32%), Positives = 61/122 (50%), Gaps = 1/122 (0%)
Frame = -3

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGL- 188
++L+ + G L AR VFD V WTA++ GY+ YG ++EA L E G+
Sbjct: 121 NNLISSCVRLGDLVYARKVFDSMPEKNTVTWTAMIDGYLKYGLEDEAFALFEDYVKHGIR 180

Query: 187 CLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQD 8
+ M+ C LN C + + + +H ++K G +L V S LV YA+CG + A
Sbjct: 181 FTNERMFVCLLNLCSRRAEFELGRQVHGNMVKVGVG-NLIVESSLVYFYAQCGELTSALR 239

Query: 7 VF 2
F
Sbjct: 240 AF 241


>sp|Q9LIC3|PP227_ARATH Putative pentatricopeptide repeat-containing
protein At3g13770, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-H85 PE=3 SV=1
Length = 628

Score = 111 bits (278), Expect = 2e-24
Identities = 60/181 (33%), Positives = 96/181 (53%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G + + +EM PN ++ L SC R+S L G +HG +V+ +D+ +
Sbjct: 132 GHSSEALTVFAEMMRSDGKPNEFTFATVLTSCIRASGLGLGKQIHGLIVKWNYDSHIFVG 191

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
SSL+DMYAK G + EAR +F+ +V+ TA++AGY G DEEAL + + SEG+
Sbjct: 192 SSLLDMYAKAGQIKEAREIFECLPERDVVSCTAIIAGYAQLGLDEEALEMFHRLHSEGMS 251

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
+ V YA L A +D + H +L+ + + L+D Y+KCG++ A+ +
Sbjct: 252 PNYVTYASLLTALSGLALLDHGKQAHCHVLRRELPFYAVLQNSLIDMYSKCGNLSYARRL 311

Query: 4 F 2
F
Sbjct: 312 F 312



Score = 85.9 bits (211), Expect = 1e-16
Identities = 52/175 (29%), Positives = 88/175 (50%), Gaps = 1/175 (0%)
Frame = -3

Query: 523 KCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMY 344
+ L EM + G Y L +C AL +G +H +++ + + + L+ Y
Sbjct: 38 EALLEMAMLGPEMGFHGYDALLNACLDKRALRDGQRVHAHMIKTRYLPATYLRTRLLIFY 97

Query: 343 AKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLL-ETMQSEGLCLDAVMY 167
KC L +AR V D +V+WTA+++ Y G EAL + E M+S+G + +
Sbjct: 98 GKCDCLEDARKVLDEMPEKNVVSWTAMISRYSQTGHSSEALTVFAEMMRSDGKP-NEFTF 156

Query: 166 ACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
A L +C + + + +H I+K Y ++VGS L+D YAK G + EA+++F
Sbjct: 157 ATVLTSCIRASGLGLGKQIHGLIVKWNYDSHIFVGSSLLDMYAKAGQIKEAREIF 211



Score = 80.5 bits (197), Expect = 5e-15
Identities = 51/183 (27%), Positives = 86/183 (46%), Gaps = 3/183 (1%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G E ++ + +G++PN V+Y L + S + L+ G H ++R
Sbjct: 230 AQLGLDEEALEMFHRLHSEGMSPNYVTYASLLTALSGLALLDHGKQAHCHVLRRELPFYA 289

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ +SL+DMY+KCG+L+ AR +FD ++W A++ GY +G E L L M+ E
Sbjct: 290 VLQNSLIDMYSKCGNLSYARRLFDNMPERTAISWNAMLVGYSKHGLGREVLELFRLMRDE 349

Query: 193 -GLCLDAVMYACSLNACGSSRQVDRVQHLHAEIL--KEGYKIDLYVGSVLVDCYAKCGSV 23
+ DAV L+ C R D ++ ++ + G K +VD + G +
Sbjct: 350 KRVKPDAVTLLAVLSGCSHGRMEDTGLNIFDGMVAGEYGTKPGTEHYGCIVDMLGRAGRI 409

Query: 22 VEA 14
EA
Sbjct: 410 DEA 412


>sp|Q9MA85|PP215_ARATH Pentatricopeptide repeat-containing protein
At3g05340 OS=Arabidopsis thaliana GN=PCMP-E83 PE=2 SV=2
Length = 658

Score = 111 bits (277), Expect = 3e-24
Identities = 57/178 (32%), Positives = 102/178 (57%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
E G++ S M+ V PN+V+Y+ AL +CS S + EG +H L + G +++ CI S+L
Sbjct: 238 EDGLRLFSLMRRGLVHPNSVTYLSALAACSGSQRIVEGQQIHALLWKYGIESELCIESAL 297

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
+DMY+KCGS+ +A +F+ T+ V+ T ++ G G +EEA+ M G+ +DA
Sbjct: 298 MDMYSKCGSIEDAWTIFESTTEVDEVSMTVILVGLAQNGSEEEAIQFFIRMLQAGVEIDA 357

Query: 175 VMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ + L + + LH+ ++K + + +V + L++ Y+KCG + ++Q VF
Sbjct: 358 NVVSAVLGVSFIDNSLGLGKQLHSLVIKRKFSGNTFVNNGLINMYSKCGDLTDSQTVF 415



Score = 82.8 bits (203), Expect = 1e-15
Identities = 42/138 (30%), Positives = 76/138 (55%)
Frame = -3

Query: 415 LHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGF 236
+H + +G+D + + + L+ Y KCG R VFD S ++ TA+++G ++
Sbjct: 177 IHALAILSGYDKEISVGNKLITSYFKCGCSVSGRGVFDGMSHRNVITLTAVISGLIENEL 236

Query: 235 DEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSV 56
E+ L L M+ + ++V Y +L AC S+++ Q +HA + K G + +L + S
Sbjct: 237 HEDGLRLFSLMRRGLVHPNSVTYLSALAACSGSQRIVEGQQIHALLWKYGIESELCIESA 296

Query: 55 LVDCYAKCGSVVEAQDVF 2
L+D Y+KCGS+ +A +F
Sbjct: 297 LMDMYSKCGSIEDAWTIF 314



Score = 63.5 bits (153), Expect = 6e-10
Identities = 47/183 (25%), Positives = 85/183 (46%), Gaps = 2/183 (1%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G E I+ M GV +A L ++L G LH +++ F +
Sbjct: 333 AQNGSEEEAIQFFIRMLQAGVEIDANVVSAVLGVSFIDNSLGLGKQLHSLVIKRKFSGNT 392

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ + L++MY+KCG L +++ VF R V+W +++A + +G AL L E M +
Sbjct: 393 FVNNGLINMYSKCGDLTDSQTVFRRMPKRNYVSWNSMIAAFARHGHGLAALKLYEEMTTL 452

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVG--SVLVDCYAKCGSVV 20
+ V + L+AC +D+ + L E +KE + I+ + ++D + G +
Sbjct: 453 EVKPTDVTFLSLLHACSHVGLIDKGRELLNE-MKEVHGIEPRTEHYTCIIDMLGRAGLLK 511

Query: 19 EAQ 11
EA+
Sbjct: 512 EAK 514



Score = 54.3 bits (129), Expect = 4e-07
Identities = 34/121 (28%), Positives = 56/121 (46%)
Frame = -3

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
+SL+ +YAKCG L +A +FD +++ + G++ E LL+ M G
Sbjct: 94 NSLLSLYAKCGKLVDAIKLFDEMPMRDVISQNIVFYGFLRNRETESGFVLLKRMLGSG-G 152

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
D L+ C + + +HA + GY ++ VG+ L+ Y KCG V + V
Sbjct: 153 FDHATLTIVLSVCDTPEFCLVTKMIHALAILSGYDKEISVGNKLITSYFKCGCSVSGRGV 212

Query: 4 F 2
F
Sbjct: 213 F 213


>sp|Q9STE1|PP333_ARATH Pentatricopeptide repeat-containing protein
At4g21300 OS=Arabidopsis thaliana GN=PCMP-E36 PE=2 SV=1
Length = 857

Score = 110 bits (276), Expect = 4e-24
Identities = 57/181 (31%), Positives = 98/181 (54%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G + IK S M++ ++PNAV++ L C+ ++ G+ LHG +V +G D + I
Sbjct: 218 GALDSVIKGFSVMRMDQISPNAVTFDCVLSVCASKLLIDLGVQLHGLVVVSGVDFEGSIK 277

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
+SL+ MY+KCG +A +F S V W +++GYV G EE+L M S G+
Sbjct: 278 NSLLSMYSKCGRFDDASKLFRMMSRADTVTWNCMISGYVQSGLMEESLTFFYEMISSGVL 337

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
DA+ ++ L + ++ + +H I++ +D+++ S L+D Y KC V AQ++
Sbjct: 338 PDAITFSSLLPSVSKFENLEYCKQIHCYIMRHSISLDIFLTSALIDAYFKCRGVSMAQNI 397

Query: 4 F 2
F
Sbjct: 398 F 398



Score = 96.7 bits (239), Expect = 7e-20
Identities = 50/164 (30%), Positives = 86/164 (52%)
Frame = -3

Query: 493 VAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEAR 314
++PN ++ + L AL G LHG +++ GFD I +++DMYAKCG + A
Sbjct: 437 ISPNEITLVSILPVIGILLALKLGRELHGFIIKKGFDNRCNIGCAVIDMYAKCGRMNLAY 496

Query: 313 FVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSR 134
+F+R S +V+W +++ A+++ M G+C D V + +L+AC +
Sbjct: 497 EIFERLSKRDIVSWNSMITRCAQSDNPSAAIDIFRQMGVSGICYDCVSISAALSACANLP 556

Query: 133 QVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ +H ++K D+Y S L+D YAKCG++ A +VF
Sbjct: 557 SESFGKAIHGFMIKHSLASDVYSESTLIDMYAKCGNLKAAMNVF 600



Score = 80.5 bits (197), Expect = 5e-15
Identities = 46/181 (25%), Positives = 89/181 (49%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G E + EM GV P+A+++ L S S+ L +H ++R D +
Sbjct: 319 GLMEESLTFFYEMISSGVLPDAITFSSLLPSVSKFENLEYCKQIHCYIMRHSISLDIFLT 378

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
S+L+D Y KC ++ A+ +F + ++ +V +TA+++GY+ G ++L + + +
Sbjct: 379 SALIDAYFKCRGVSMAQNIFSQCNSVDVVVFTAMISGYLHNGLYIDSLEMFRWLVKVKIS 438

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
+ + L G + + LH I+K+G+ +G ++D YAKCG + A ++
Sbjct: 439 PNEITLVSILPVIGILLALKLGRELHGFIIKKGFDNRCNIGCAVIDMYAKCGRMNLAYEI 498

Query: 4 F 2
F
Sbjct: 499 F 499



Score = 66.2 bits (160), Expect = 1e-10
Identities = 44/175 (25%), Positives = 87/175 (49%), Gaps = 2/175 (1%)
Frame = -3

Query: 526 IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDM 347
I +M + G+ + VS AL +C+ + + G +HG +++ +D S+L+DM
Sbjct: 527 IDIFRQMGVSGICYDCVSISAALSACANLPSESFGKAIHGFMIKHSLASDVYSESTLIDM 586

Query: 346 YAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLL-ETMQSEGLCLDAVM 170
YAKCG+L A VF +V+W +++A ++G +++L L E ++ G+ D +
Sbjct: 587 YAKCGNLKAAMNVFKTMKEKNIVSWNSIIAACGNHGKLKDSLCLFHEMVEKSGIRPDQIT 646

Query: 169 YACSLNACGSSRQVDR-VQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQD 8
+ +++C VD V+ + G + + +VD + + G + EA +
Sbjct: 647 FLEIISSCCHVGDVDEGVRFFRSMTEDYGIQPQQEHYACVVDLFGRAGRLTEAYE 701



Score = 65.1 bits (157), Expect = 2e-10
Identities = 38/165 (23%), Positives = 72/165 (43%)
Frame = -3

Query: 496 GVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEA 317
GV+P+ ++ +++C L + G D + + SSL+ Y + G +
Sbjct: 133 GVSPDVSTFPCLVKACVALKNFKGIDFLSDTVSSLGMDCNEFVASSLIKAYLEYGKIDVP 192

Query: 316 RFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSS 137
+FDR V W ++ GY G + + M+ + + +AV + C L+ C S
Sbjct: 193 SKLFDRVLQKDCVIWNVMLNGYAKCGALDSVIKGFSVMRMDQISPNAVTFDCVLSVCASK 252

Query: 136 RQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+D LH ++ G + + + L+ Y+KCG +A +F
Sbjct: 253 LLIDLGVQLHGLVVVSGVDFEGSIKNSLLSMYSKCGRFDDASKLF 297



Score = 57.8 bits (138), Expect = 4e-08
Identities = 37/162 (22%), Positives = 71/162 (43%), Gaps = 2/162 (1%)
Frame = -3

Query: 502 LQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLA 323
L+ P +S + L++CS + L +G +H L+ D ++ MYA CGS +
Sbjct: 30 LEETIPRRLSLL--LQACSNPNLLRQGKQVHAFLIVNSISGDSYTDERILGMYAMCGSFS 87

Query: 322 EARFVFDRTS--TPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNA 149
+ +F R ++ W ++++ +V G +AL M G+ D + C + A
Sbjct: 88 DCGKMFYRLDLRRSSIRPWNSIISSFVRNGLLNQALAFYFKMLCFGVSPDVSTFPCLVKA 147

Query: 148 CGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSV 23
C + + + L + G + +V S L+ Y + G +
Sbjct: 148 CVALKNFKGIDFLSDTVSSLGMDCNEFVASSLIKAYLEYGKI 189


>sp|P93011|PP182_ARATH Pentatricopeptide repeat-containing protein
At2g33760 OS=Arabidopsis thaliana GN=PCMP-H6 PE=2 SV=1
Length = 583

Score = 110 bits (276), Expect = 4e-24
Identities = 55/177 (31%), Positives = 98/177 (55%)
Frame = -3

Query: 532 HGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLV 353
H + M V+P+ ++ ++SC+ SAL G +H V +GF D + ++LV
Sbjct: 90 HCVAYYRRMLSSNVSPSNYTFTSVIKSCADLSALRIGKGVHCHAVVSGFGLDTYVQAALV 149

Query: 352 DMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAV 173
Y+KCG + AR VFDR ++VAW +L++G+ G +EA+ + M+ G D+
Sbjct: 150 TFYSKCGDMEGARQVFDRMPEKSIVAWNSLVSGFEQNGLADEAIQVFYQMRESGFEPDSA 209

Query: 172 MYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ L+AC + V +H I+ EG +++ +G+ L++ Y++CG V +A++VF
Sbjct: 210 TFVSLLSACAQTGAVSLGSWVHQYIISEGLDLNVKLGTALINLYSRCGDVGKAREVF 266



Score = 84.3 bits (207), Expect = 4e-16
Identities = 45/179 (25%), Positives = 98/179 (54%), Gaps = 2/179 (1%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G A+ I+ +M+ G P++ +++ L +C+++ A++ G +H ++ G D + +
Sbjct: 187 GLADEAIQVFYQMRESGFEPDSATFVSLLSACAQTGAVSLGSWVHQYIISEGLDLNVKLG 246

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE-GL 188
++L+++Y++CG + +AR VFD+ + AWTA+++ Y +G+ ++A+ L M+ + G
Sbjct: 247 TALINLYSRCGDVGKAREVFDKMKETNVAAWTAMISAYGTHGYGQQAVELFNKMEDDCGP 306

Query: 187 CLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSV-LVDCYAKCGSVVEA 14
+ V + L+AC + V+ + ++ + K I V +VD + G + EA
Sbjct: 307 IPNNVTFVAVLSACAHAGLVEEGRSVYKRMTKSYRLIPGVEHHVCMVDMLGRAGFLDEA 365


>sp|Q9ZQ74|PP146_ARATH Pentatricopeptide repeat-containing protein
At2g03380, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E47 PE=2 SV=1
Length = 689

Score = 110 bits (274), Expect = 6e-24
Identities = 62/178 (34%), Positives = 98/178 (55%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
E G+ + M+ V N +Y + +C++ SAL++G HG LV++G + C+++SL
Sbjct: 224 EEGLVLFNRMRENNVLGNEYTYGTLIMACTKLSALHQGKWFHGCLVKSGIELSSCLVTSL 283

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
+DMY KCG ++ AR VF+ S LV WTA++ GY G EAL+L + M+ + +
Sbjct: 284 LDMYVKCGDISNARRVFNEHSHVDLVMWTAMIVGYTHNGSVNEALSLFQKMKGVEIKPNC 343

Query: 175 VMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
V A L+ CG ++ + +H +K G D V + LV YAKC +A+ VF
Sbjct: 344 VTIASVLSGCGLIENLELGRSVHGLSIKVGI-WDTNVANALVHMYAKCYQNRDAKYVF 400



Score = 93.6 bits (231), Expect = 6e-19
Identities = 57/183 (31%), Positives = 90/183 (49%), Gaps = 2/183 (1%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G + +M+ + PN V+ L C L G +HG ++ G D +
Sbjct: 322 GSVNEALSLFQKMKGVEIKPNCVTIASVLSGCGLIENLELGRSVHGLSIKVGI-WDTNVA 380

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
++LV MYAKC +A++VF+ S +VAW ++++G+ G EAL L M SE +
Sbjct: 381 NALVHMYAKCYQNRDAKYVFEMESEKDIVAWNSIISGFSQNGSIHEALFLFHRMNSESVT 440

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGY--KIDLYVGSVLVDCYAKCGSVVEAQ 11
+ V A +AC S + LHA +K G+ ++VG+ L+D YAKCG A+
Sbjct: 441 PNGVTVASLFSACASLGSLAVGSSLHAYSVKLGFLASSSVHVGTALLDFYAKCGDPQSAR 500

Query: 10 DVF 2
+F
Sbjct: 501 LIF 503



Score = 89.7 bits (221), Expect = 8e-18
Identities = 49/175 (28%), Positives = 89/175 (50%)
Frame = -3

Query: 526 IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDM 347
+K + G + + + +AL++C+ L+ G +H +LV+ D +++ L+DM
Sbjct: 127 VKLYDLLMKHGFRYDDIVFSKALKACTELQDLDNGKKIHCQLVKVP-SFDNVVLTGLLDM 185

Query: 346 YAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMY 167
YAKCG + A VF+ + +V WT+++AGYV EE L L M+ + + Y
Sbjct: 186 YAKCGEIKSAHKVFNDITLRNVVCWTSMIAGYVKNDLCEEGLVLFNRMRENNVLGNEYTY 245

Query: 166 ACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ AC + + + H ++K G ++ + + L+D Y KCG + A+ VF
Sbjct: 246 GTLIMACTKLSALHQGKWFHGCLVKSGIELSSCLVTSLLDMYVKCGDISNARRVF 300



Score = 72.8 bits (177), Expect = 1e-12
Identities = 47/186 (25%), Positives = 82/186 (44%), Gaps = 3/186 (1%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
+ G + M + V PN V+ +C+ +L G LH V+ GF A
Sbjct: 419 SQNGSIHEALFLFHRMNSESVTPNGVTVASLFSACASLGSLAVGSSLHAYSVKLGFLASS 478

Query: 373 CII--SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQ 200
+ ++L+D YAKCG AR +FD + W+A++ GY G +L L E M
Sbjct: 479 SVHVGTALLDFYAKCGDPQSARLIFDTIEEKNTITWSAMIGGYGKQGDTIGSLELFEEML 538

Query: 199 SEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKE-GYKIDLYVGSVLVDCYAKCGSV 23
+ + + L+ACG + V+ + + + K+ + + +VD A+ G +
Sbjct: 539 KKQQKPNESTFTSILSACGHTGMVNEGKKYFSSMYKDYNFTPSTKHYTCMVDMLARAGEL 598

Query: 22 VEAQDV 5
+A D+
Sbjct: 599 EQALDI 604



Score = 70.5 bits (171), Expect = 5e-12
Identities = 43/153 (28%), Positives = 70/153 (45%)
Frame = -3

Query: 460 LRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFVFDRTSTPAL 281
L C+ +L + HG L G D I + LV +Y G +AR VFD+ P
Sbjct: 51 LSKCTNIDSLRQS---HGVLTGNGLMGDISIATKLVSLYGFFGYTKDARLVFDQIPEPDF 107

Query: 280 VAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAE 101
W ++ Y E + L + + G D ++++ +L AC + +D + +H +
Sbjct: 108 YLWKVMLRCYCLNKESVEVVKLYDLLMKHGFRYDDIVFSKALKACTELQDLDNGKKIHCQ 167

Query: 100 ILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++K D V + L+D YAKCG + A VF
Sbjct: 168 LVKVP-SFDNVVLTGLLDMYAKCGEIKSAHKVF 199


tr_hit_id A9T8E9
Definition tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 184
Score (bit) 140.0
E-value 3.0e-32
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919242|Adiantum capillus-veneris mRNA, clone:
YMU001_000122_G11.
(555 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella paten... 140 3e-32
tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella paten... 136 7e-31
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 134 3e-30
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 134 3e-30
tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome... 132 1e-29
tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis... 132 1e-29
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 131 2e-29
tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella paten... 130 4e-29
tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 129 1e-28
tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella paten... 129 1e-28
tr|A9T480|A9T480_PHYPA Predicted protein (Fragment) OS=Physcomit... 128 2e-28
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 126 9e-28
tr|A9S537|A9S537_PHYPA Predicted protein OS=Physcomitrella paten... 125 1e-27
tr|A7PW61|A7PW61_VITVI Chromosome chr8 scaffold_34, whole genome... 125 1e-27
tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea... 125 2e-27
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 124 3e-27
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 124 3e-27
tr|A7PEB0|A7PEB0_VITVI Chromosome chr11 scaffold_13, whole genom... 123 7e-27
tr|A7PWA0|A7PWA0_VITVI Chromosome chr8 scaffold_34, whole genome... 121 2e-26
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 121 3e-26
tr|Q94E87|Q94E87_ORYSJ PPR-repeat protein-like (Putative unchara... 120 4e-26
tr|A9RSU9|A9RSU9_PHYPA Predicted protein OS=Physcomitrella paten... 120 4e-26
tr|A2WQ53|A2WQ53_ORYSI Putative uncharacterized protein OS=Oryza... 120 4e-26
tr|A7PM23|A7PM23_VITVI Chromosome chr14 scaffold_21, whole genom... 120 6e-26
tr|A7QIL2|A7QIL2_VITVI Chromosome chr9 scaffold_104, whole genom... 119 8e-26
tr|B6SWY6|B6SWY6_MAIZE Pentatricopeptide repeat protein PPR1106-... 119 1e-25
tr|A7PQZ4|A7PQZ4_VITVI Chromosome chr6 scaffold_25, whole genome... 119 1e-25
tr|A7NXD6|A7NXD6_VITVI Chromosome chr5 scaffold_2, whole genome ... 119 1e-25
tr|A7NSK1|A7NSK1_VITVI Chromosome chr18 scaffold_1, whole genome... 119 1e-25
tr|A5BMC7|A5BMC7_VITVI Putative uncharacterized protein OS=Vitis... 119 1e-25

>tr|A9T8E9|A9T8E9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_192620 PE=4 SV=1
Length = 902

Score = 140 bits (354), Expect = 3e-32
Identities = 66/184 (35%), Positives = 113/184 (61%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A+ G E + ++MQ +GV PN ++Y+ L +C S+AL+ G +H + +AGF +D
Sbjct: 304 AEGGYWEEASEVYNQMQREGVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDI 363

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++L+ MY++CGS+ +AR VFD+ +++WTA++ G GF EAL + + MQ
Sbjct: 364 GVQNALISMYSRCGSIKDARLVFDKMVRKDVISWTAMIGGLAKSGFGAEALTVYQEMQQA 423

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ + V Y LNAC S ++ + +H ++++ G D +VG+ LV+ Y+ CGSV +A
Sbjct: 424 GVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDAHVGNTLVNMYSMCGSVKDA 483

Query: 13 QDVF 2
+ VF
Sbjct: 484 RQVF 487



Score = 137 bits (345), Expect = 4e-31
Identities = 73/184 (39%), Positives = 104/184 (56%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G + EMQ GV PN V+Y L +CS +AL G +H ++V AG D
Sbjct: 405 AKSGFGAEALTVYQEMQQAGVEPNRVTYTSILNACSSPAALEWGRRIHQQVVEAGLATDA 464

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV+MY+ CGS+ +AR VFDR +VA+ A++ GY + +EAL L + +Q E
Sbjct: 465 HVGNTLVNMYSMCGSVKDARQVFDRMIQRDIVAYNAMIGGYAAHNLGKEALKLFDRLQEE 524

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
GL D V Y LNAC +S ++ + +H + K G+ D VG+ LV YAKCGS +A
Sbjct: 525 GLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNALVSTYAKCGSFSDA 584

Query: 13 QDVF 2
VF
Sbjct: 585 SIVF 588



Score = 129 bits (324), Expect = 1e-28
Identities = 63/184 (34%), Positives = 107/184 (58%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
AD G +E + +M+ +GV PN ++YI L + S +AL G +H ++ AG ++D
Sbjct: 203 ADCGRSETAFEIFQKMEQEGVVPNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDT 262

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV MYAKCGS + R VF++ L+AW ++ G + G+ EEA + MQ E
Sbjct: 263 AVGTALVKMYAKCGSYKDCRQVFEKLVNRDLIAWNTMIGGLAEGGYWEEASEVYNQMQRE 322

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ + + Y LNAC +S + + +H+ + K G+ D+ V + L+ Y++CGS+ +A
Sbjct: 323 GVMPNKITYVILLNACVNSAALHWGKEIHSRVAKAGFTSDIGVQNALISMYSRCGSIKDA 382

Query: 13 QDVF 2
+ VF
Sbjct: 383 RLVF 386



Score = 128 bits (322), Expect = 2e-28
Identities = 66/181 (36%), Positives = 102/181 (56%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G E +K L +MQ G+AP+ + + L SC AL G +H + ++AG D +
Sbjct: 105 GYIEKALKLLRQMQQHGLAPDRTTIMSFLSSCKSPGALEWGREIHFQAMQAGLLFDVKVA 164

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
+ +++MYAKCGS+ EAR VFD+ ++V+WT + GY D G E A + + M+ EG+
Sbjct: 165 NCILNMYAKCGSIEEAREVFDKMEKKSVVSWTITIGGYADCGRSETAFEIFQKMEQEGVV 224

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
+ + Y LNA S + + +H+ IL G++ D VG+ LV YAKCGS + + V
Sbjct: 225 PNRITYISVLNAFSSPAALKWGKAVHSRILNAGHESDTAVGTALVKMYAKCGSYKDCRQV 284

Query: 4 F 2
F
Sbjct: 285 F 285



Score = 108 bits (270), Expect = 2e-22
Identities = 55/171 (32%), Positives = 97/171 (56%), Gaps = 2/171 (1%)
Frame = -3

Query: 508 MQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGS 329
+Q QG N+ Y++ L+ C L G +H +++ D +++L++MY +CGS
Sbjct: 14 LQQQGAQVNSSDYMKMLKRCIEVKDLVAGRQVHQHIIQHRTVPDQYTVNALINMYIQCGS 73

Query: 328 LAEARFVFDRTS--TPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSL 155
+ EAR V+ + S + +W A++ GY+ YG+ E+AL LL MQ GL D L
Sbjct: 74 IEEARQVWKKLSYMERTVHSWNAMVVGYIQYGYIEKALKLLRQMQQHGLAPDRTTIMSFL 133

Query: 154 NACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++C S ++ + +H + ++ G D+ V + +++ YAKCGS+ EA++VF
Sbjct: 134 SSCKSPGALEWGREIHFQAMQAGLLFDVKVANCILNMYAKCGSIEEAREVF 184



Score = 93.6 bits (231), Expect = 6e-18
Identities = 47/150 (31%), Positives = 83/150 (55%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
+ +K +Q +G+ P+ V+YI L +C+ S +L +H + + GF +D + ++L
Sbjct: 512 KEALKLFDRLQEEGLKPDKVTYINMLNACANSGSLEWAREIHTLVRKGGFFSDTSVGNAL 571

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
V YAKCGS ++A VF++ + +++W A++ G +G ++AL L E M+ EG+ D
Sbjct: 572 VSTYAKCGSFSDASIVFEKMTKRNVISWNAIIGGSAQHGRGQDALQLFERMKMEGVKPDI 631

Query: 175 VMYACSLNACGSSRQVDRVQHLHAEILKEG 86
V + L+AC HA +L+EG
Sbjct: 632 VTFVSLLSACS-----------HAGLLEEG 650



Score = 38.1 bits (87), Expect = 0.32
Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 7/83 (8%)
Frame = -3

Query: 544 GCAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDA 380
G A+HG ++ M+++GV P+ V+++ L +CS + L EG + + F
Sbjct: 605 GSAQHGRGQDALQLFERMKMEGVKPDIVTFVSLLSACSHAGLLEEGRRYFCSMSQ-DFAI 663

Query: 379 DPCI--ISSLVDMYAKCGSLAEA 317
P I +VD+ + G L EA
Sbjct: 664 IPTIEHYGCMVDLLGRAGQLDEA 686


>tr|A9RJW2|A9RJW2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_175641 PE=4 SV=1
Length = 723

Score = 136 bits (343), Expect = 7e-31
Identities = 64/184 (34%), Positives = 107/184 (58%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A +G + ++ L MQ VAPN +++ L+ C+ +AL G +H ++++G+ +
Sbjct: 225 AQQGQVDVALELLETMQQAEVAPNKITFASILQGCTTPAALEHGKKVHRYIIQSGYGREL 284

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+++SL+ MY KCG L EAR +F +V WTA++ GY GF +EA+NL MQ +
Sbjct: 285 WVVNSLITMYCKCGGLEEARKLFSDLPHRDVVTWTAMVTGYAQLGFHDEAINLFRRMQQQ 344

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ D + + L +C S + + +H +++ GY +D+Y+ S LV YAKCGS+ +A
Sbjct: 345 GIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDVYLQSALVSMYAKCGSMDDA 404

Query: 13 QDVF 2
VF
Sbjct: 405 SLVF 408



Score = 127 bits (318), Expect = 5e-28
Identities = 63/174 (36%), Positives = 101/174 (58%)
Frame = -3

Query: 523 KCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMY 344
KC M+L G P+ V+++ L + + L G +H E+V AG + +P + +SLV MY
Sbjct: 134 KCYETMKLAGCKPDKVTFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMY 193

Query: 343 AKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYA 164
AKCG +++AR +FDR +V WT L+AGY G + AL LLETMQ + + + +A
Sbjct: 194 AKCGDISKARVIFDRLPEKNVVTWTLLIAGYAQQGQVDVALELLETMQQAEVAPNKITFA 253

Query: 163 CSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
L C + ++ + +H I++ GY +L+V + L+ Y KCG + EA+ +F
Sbjct: 254 SILQGCTTPAALEHGKKVHRYIIQSGYGRELWVVNSLITMYCKCGGLEEARKLF 307



Score = 106 bits (265), Expect = 7e-22
Identities = 64/185 (34%), Positives = 99/185 (53%), Gaps = 2/185 (1%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G + I MQ QG+ P+ +++ L SCS + L EG +H +LV AG++ D
Sbjct: 326 AQLGFHDEAINLFRRMQQQGIKPDKMTFTSVLTSCSSPAFLQEGKRIHQQLVHAGYNLDV 385

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAG-YVDYGFDEEALNLLETMQS 197
+ S+LV MYAKCGS+ +A VF++ S +VAWTA++ G +G EAL + M+
Sbjct: 386 YLQSALVSMYAKCGSMDDASLVFNQMSERNVVAWTAIITGCCAQHGRCREALEYFDQMKK 445

Query: 196 EGLCLDAVMYACSLNACGSSRQVDR-VQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVV 20
+G+ D V + L+AC V+ +H + L G K + S VD + G +
Sbjct: 446 QGIKPDKVTFTSVLSACTHVGLVEEGRKHFRSMYLDYGIKPMVEHYSCFVDLLGRAGHLE 505

Query: 19 EAQDV 5
EA++V
Sbjct: 506 EAENV 510



Score = 105 bits (262), Expect = 2e-21
Identities = 58/181 (32%), Positives = 100/181 (55%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G + + ++ M LQG + + L+ C+R +L +G +H ++++G + +
Sbjct: 26 GRLKEALGIMNTMILQGTRVYSDVFRGLLQECARLRSLEQGREVHAAILKSGIQPNRYLE 85

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
++L+ MYAKCGSL +AR VFD +V+WTA++ +V + EA ETM+ G
Sbjct: 86 NTLLSMYAKCGSLTDARRVFDSIRDRNIVSWTAMIEAFVAGNKNLEAFKCYETMKLAGCK 145

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
D V + LNA + + Q +H EI++ G +++ VG+ LV YAKCG + +A+ +
Sbjct: 146 PDKVTFVSLLNAFTNPELLQLGQKVHMEIVEAGLELEPRVGTSLVGMYAKCGDISKARVI 205

Query: 4 F 2
F
Sbjct: 206 F 206


>tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1
Length = 868

Score = 134 bits (337), Expect = 3e-30
Identities = 65/178 (36%), Positives = 108/178 (60%), Gaps = 6/178 (3%)
Frame = -3

Query: 517 LSEMQLQ-GVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYA 341
L E LQ G++PNAV+++ L SC+ ALN G +H + G + D + ++L+ MY
Sbjct: 245 LYEQMLQAGISPNAVTFVSLLNSCNTPEALNRGRRIHSHISERGLETDMIVANALITMYC 304

Query: 340 KCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFD-----EEALNLLETMQSEGLCLDA 176
KC S+ EAR +FDR S +++W+A++AGY G+ +E LLE M+ EG+ +
Sbjct: 305 KCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGYKDKESIDEVFQLLERMRREGVFPNK 364

Query: 175 VMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
V + L AC + +++ + +HAE+ K G+++D + + + + YAKCGS+ EA+ VF
Sbjct: 365 VTFMSILRACTAHGALEQGRQIHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVF 422



Score = 121 bits (303), Expect = 3e-26
Identities = 69/214 (32%), Positives = 109/214 (50%), Gaps = 31/214 (14%)
Frame = -3

Query: 550 DKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPC 371
DK + + L M+ +GV PN V+++ LR+C+ AL +G +H EL + GF+ D
Sbjct: 341 DKESIDEVFQLLERMRREGVFPNKVTFMSILRACTAHGALEQGRQIHAELSKVGFELDRS 400

Query: 370 IISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTA------------------------- 266
+ +++ +MYAKCGS+ EA VF + + +VAWT+
Sbjct: 401 LQTAIFNMYAKCGSIYEAEQVFSKMANKNVVAWTSFLSMYIKCGDLSSAEKVFSEMPTRN 460

Query: 265 ------LMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHA 104
++AGY G + LL +M++EG D V L ACG+ ++R + +HA
Sbjct: 461 VVSWNLMIAGYAQNGDIVKVFELLSSMKAEGFQPDRVTVITILEACGALAGLERGKLVHA 520

Query: 103 EILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
E +K G + D V + L+ Y+KCG V EA+ VF
Sbjct: 521 EAVKLGLESDTVVATSLIGMYSKCGQVAEARTVF 554



Score = 107 bits (267), Expect = 4e-22
Identities = 49/164 (29%), Positives = 93/164 (56%)
Frame = -3

Query: 493 VAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEAR 314
+ PN ++++ L++C+ S L +G +H + G + D + ++L+ MY+KCG ++ A
Sbjct: 153 IEPNRITFLSILKACNNYSILEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVAC 212

Query: 313 FVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSR 134
VF + + +V+WTA++ + EA L E M G+ +AV + LN+C +
Sbjct: 213 EVFHKMTERNVVSWTAIIQANAQHRKLNEAFELYEQMLQAGISPNAVTFVSLLNSCNTPE 272

Query: 133 QVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++R + +H+ I + G + D+ V + L+ Y KC SV EA+++F
Sbjct: 273 ALNRGRRIHSHISERGLETDMIVANALITMYCKCNSVQEAREIF 316



Score = 99.0 bits (245), Expect = 2e-19
Identities = 58/187 (31%), Positives = 102/187 (54%), Gaps = 8/187 (4%)
Frame = -3

Query: 544 GCAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDA 380
G A++G + LS M+ +G P+ V+ I L +C + L G +H E V+ G ++
Sbjct: 470 GYAQNGDIVKVFELLSSMKAEGFQPDRVTVITILEACGALAGLERGKLVHAEAVKLGLES 529

Query: 379 DPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQ 200
D + +SL+ MY+KCG +AEAR VFD+ S VAW A++AGY +G EA++L + M
Sbjct: 530 DTVVATSLIGMYSKCGQVAEARTVFDKMSNRDTVAWNAMLAGYGQHGDGLEAVDLFKRML 589

Query: 199 SEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKI---DLYVGSVLVDCYAKCG 29
E + + + ++AC + V + + +++E +K+ + G +VD + G
Sbjct: 590 KERVSPNEITLTAVISACSRAGLVQEGREIF-RMMQEDFKMTPRKQHYG-CMVDLLGRAG 647

Query: 28 SVVEAQD 8
+ EA++
Sbjct: 648 RLQEAEE 654



Score = 79.7 bits (195), Expect = 9e-14
Identities = 43/181 (23%), Positives = 90/181 (49%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G I+ L ++ +G+ N+ +Y + C+++ +G +H +L G + D +
Sbjct: 35 GRLREAIQLLGIIKQRGLLVNSNTYGCVIEHCAKARRFEDGKMVHKQLDELGVEIDIYLG 94

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
+SL++ Y+K +A A VF R + +V W++++A Y +A + E M +
Sbjct: 95 NSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDANIE 154

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
+ + + L AC + +++ + +H + G + D+ V + L+ Y+KCG + A +V
Sbjct: 155 PNRITFLSILKACNNYSILEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVACEV 214

Query: 4 F 2
F
Sbjct: 215 F 215


>tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211228 PE=4 SV=1
Length = 868

Score = 134 bits (337), Expect = 3e-30
Identities = 65/178 (36%), Positives = 108/178 (60%), Gaps = 6/178 (3%)
Frame = -3

Query: 517 LSEMQLQ-GVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYA 341
L E LQ G++PNAV+++ L SC+ ALN G +H + G + D + ++L+ MY
Sbjct: 245 LYEQMLQAGISPNAVTFVSLLNSCNTPEALNRGRRIHSHISERGLETDMIVANALITMYC 304

Query: 340 KCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFD-----EEALNLLETMQSEGLCLDA 176
KC S+ EAR +FDR S +++W+A++AGY G+ +E LLE M+ EG+ +
Sbjct: 305 KCNSVQEAREIFDRMSKRDVISWSAMIAGYAQSGYKDKESIDEVFQLLERMRREGVFPNK 364

Query: 175 VMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
V + L AC + +++ + +HAE+ K G+++D + + + + YAKCGS+ EA+ VF
Sbjct: 365 VTFMSILRACTAHGALEQGRQIHAELSKVGFELDRSLQTAIFNMYAKCGSIYEAEQVF 422



Score = 121 bits (303), Expect = 3e-26
Identities = 69/214 (32%), Positives = 109/214 (50%), Gaps = 31/214 (14%)
Frame = -3

Query: 550 DKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPC 371
DK + + L M+ +GV PN V+++ LR+C+ AL +G +H EL + GF+ D
Sbjct: 341 DKESIDEVFQLLERMRREGVFPNKVTFMSILRACTAHGALEQGRQIHAELSKVGFELDRS 400

Query: 370 IISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTA------------------------- 266
+ +++ +MYAKCGS+ EA VF + + +VAWT+
Sbjct: 401 LQTAIFNMYAKCGSIYEAEQVFSKMANKNVVAWTSFLSMYIKCGDLSSAEKVFSEMPTRN 460

Query: 265 ------LMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHA 104
++AGY G + LL +M++EG D V L ACG+ ++R + +HA
Sbjct: 461 VVSWNLMIAGYAQNGDIVKVFELLSSMKAEGFQPDRVTVITILEACGALAGLERGKLVHA 520

Query: 103 EILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
E +K G + D V + L+ Y+KCG V EA+ VF
Sbjct: 521 EAVKLGLESDTVVATSLIGMYSKCGQVAEARTVF 554



Score = 107 bits (267), Expect = 4e-22
Identities = 49/164 (29%), Positives = 93/164 (56%)
Frame = -3

Query: 493 VAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEAR 314
+ PN ++++ L++C+ S L +G +H + G + D + ++L+ MY+KCG ++ A
Sbjct: 153 IEPNRITFLSILKACNNYSILEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVAC 212

Query: 313 FVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSR 134
VF + + +V+WTA++ + EA L E M G+ +AV + LN+C +
Sbjct: 213 EVFHKMTERNVVSWTAIIQANAQHRKLNEAFELYEQMLQAGISPNAVTFVSLLNSCNTPE 272

Query: 133 QVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++R + +H+ I + G + D+ V + L+ Y KC SV EA+++F
Sbjct: 273 ALNRGRRIHSHISERGLETDMIVANALITMYCKCNSVQEAREIF 316



Score = 99.0 bits (245), Expect = 2e-19
Identities = 58/187 (31%), Positives = 102/187 (54%), Gaps = 8/187 (4%)
Frame = -3

Query: 544 GCAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDA 380
G A++G + LS M+ +G P+ V+ I L +C + L G +H E V+ G ++
Sbjct: 470 GYAQNGDIVKVFELLSSMKAEGFQPDRVTVITILEACGALAGLERGKLVHAEAVKLGLES 529

Query: 379 DPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQ 200
D + +SL+ MY+KCG +AEAR VFD+ S VAW A++AGY +G EA++L + M
Sbjct: 530 DTVVATSLIGMYSKCGQVAEARTVFDKMSNRDTVAWNAMLAGYGQHGDGLEAVDLFKRML 589

Query: 199 SEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKI---DLYVGSVLVDCYAKCG 29
E + + + ++AC + V + + +++E +K+ + G +VD + G
Sbjct: 590 KERVSPNEITLTAVISACSRAGLVQEGREIF-RMMQEDFKMTPRKQHYG-CMVDLLGRAG 647

Query: 28 SVVEAQD 8
+ EA++
Sbjct: 648 RLQEAEE 654



Score = 79.7 bits (195), Expect = 9e-14
Identities = 43/181 (23%), Positives = 90/181 (49%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G I+ L ++ +G+ N+ +Y + C+++ +G +H +L G + D +
Sbjct: 35 GRLREAIQLLGIIKQRGLLVNSNTYGCVIEHCAKARRFEDGKMVHKQLDELGVEIDIYLG 94

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
+SL++ Y+K +A A VF R + +V W++++A Y +A + E M +
Sbjct: 95 NSLINFYSKFEDVASAEQVFRRMTLRDVVTWSSMIAAYAGNNHPAKAFDTFERMTDANIE 154

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
+ + + L AC + +++ + +H + G + D+ V + L+ Y+KCG + A +V
Sbjct: 155 PNRITFLSILKACNNYSILEKGRKIHTIVKAMGMETDVAVATALITMYSKCGEISVACEV 214

Query: 4 F 2
F
Sbjct: 215 F 215


>tr|A7NVQ9|A7NVQ9_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015531001
PE=4 SV=1
Length = 703

Score = 132 bits (332), Expect = 1e-29
Identities = 64/184 (34%), Positives = 109/184 (59%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G ++ +K S M L G+ P+ +++ + +CS A EG +H L++ GF++
Sbjct: 286 AQSGDSDKALKLFSSMHLSGIRPSEFTFVGVINACSDLGAAWEGKQVHDYLLKLGFESQI 345

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
++++LVDMYAKC S+ +AR FD P +V WT+++ GYV G +E+AL+L M+ E
Sbjct: 346 YVMTALVDMYAKCSSIVDARKGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEME 405

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ + + A L AC S +++ + +HA +K G+ +++ +GS L YAKCG + +
Sbjct: 406 GILPNELTMASVLKACSSLAALEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDG 465

Query: 13 QDVF 2
VF
Sbjct: 466 TLVF 469



Score = 92.8 bits (229), Expect = 1e-17
Identities = 51/169 (30%), Positives = 86/169 (50%)
Frame = -3

Query: 508 MQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGS 329
M+ + N + L + + +N G +H V+ G + + ++LV MYAKCGS
Sbjct: 200 MRREEEGENEFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGS 259

Query: 328 LAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNA 149
L +A F+ +S + W+A++ GY G ++AL L +M G+ + +NA
Sbjct: 260 LDDALQTFETSSDKNSITWSAMITGYAQSGDSDKALKLFSSMHLSGIRPSEFTFVGVINA 319

Query: 148 CGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
C + +H +LK G++ +YV + LVD YAKC S+V+A+ F
Sbjct: 320 CSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDARKGF 368



Score = 92.8 bits (229), Expect = 1e-17
Identities = 48/138 (34%), Positives = 74/138 (53%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
E + M+++G+ PN ++ L++CS +AL +G +H V+ GF + I S+L
Sbjct: 393 EDALSLYGRMEMEGILPNELTMASVLKACSSLAALEQGKQIHARTVKYGFGLEVPIGSAL 452

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
MYAKCG L + VF R +++W A+++G G +EAL L E MQ EG D
Sbjct: 453 STMYAKCGCLKDGTLVFRRMPARDVISWNAMISGLSQNGCGKEALELFEEMQLEGTKPDY 512

Query: 175 VMYACSLNACGSSRQVDR 122
V + L+AC V+R
Sbjct: 513 VTFVNILSACSHMGLVER 530



Score = 79.3 bits (194), Expect = 1e-13
Identities = 49/164 (29%), Positives = 84/164 (51%), Gaps = 2/164 (1%)
Frame = -3

Query: 487 PNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFV 308
P+ S+ AL + + +L +G LH +++++ I +SLV++YAKC L EA+FV
Sbjct: 4 PSNRSFFTALLQYTHNRSLQKGKALHAQIIKSSSSC-VYIANSLVNLYAKCQRLREAKFV 62

Query: 307 FDRTSTPALVAWTALMAGYVDYG--FDEEALNLLETMQSEGLCLDAVMYACSLNACGSSR 134
F+R +V+W ++ GY +G + L + M++E +A +A A +
Sbjct: 63 FERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTAASTLV 122

Query: 133 QVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ HA +K D++VGS L++ Y K G EA+ VF
Sbjct: 123 DAAGGRLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVF 166



Score = 79.0 bits (193), Expect = 2e-13
Identities = 51/179 (28%), Positives = 81/179 (45%)
Frame = -3

Query: 538 AEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISS 359
+ H ++ M+ + APNA ++ + S G H ++ D + SS
Sbjct: 89 SSHVMELFQRMRAENTAPNAHTFAGVFTAASTLVDAAGGRLAHAVAIKMDSCRDVFVGSS 148

Query: 358 LVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLD 179
L++MY K G EAR VFD V+W +++GY EAL L M+ E +
Sbjct: 149 LMNMYCKAGLTPEARKVFDTMPERNSVSWATMISGYASQKLAAEALGLFRLMRREEEGEN 208

Query: 178 AVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++ L+A V+ + +H +K G + VG+ LV YAKCGS+ +A F
Sbjct: 209 EFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGSLDDALQTF 267



Score = 47.8 bits (112), Expect = 4e-04
Identities = 37/157 (23%), Positives = 70/157 (44%), Gaps = 9/157 (5%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
+ GC + ++ EMQL+G P+ V+++ L +CS + G + ++ F DP
Sbjct: 488 SQNGCGKEALELFEEMQLEGTKPDYVTFVNILSACSHMGLVERGWG-YFRMMFDEFGMDP 546

Query: 373 CI--ISSLVDMYAKCGSLAEA-RFVFDRTSTPALVAWTALMAGYVDY------GFDEEAL 221
+ + +VD+ ++ G L EA F T + W ++ +Y + E L
Sbjct: 547 RVEHYACMVDILSRAGKLKEAIEFTESATIDHGMCLWRIILGACRNYRNYELGAYAGEKL 606

Query: 220 NLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHL 110
L + +S L + +Y +A G V+RV+ +
Sbjct: 607 MELGSQESSAYVLLSSIY----SALGRWEDVERVRRM 639


>tr|A5AJZ0|A5AJZ0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031846 PE=4 SV=1
Length = 654

Score = 132 bits (332), Expect = 1e-29
Identities = 64/184 (34%), Positives = 109/184 (59%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G ++ +K S M L G+ P+ +++ + +CS A EG +H L++ GF++
Sbjct: 286 AQSGDSDKALKLFSSMHLSGIRPSEFTFVGVINACSDLGAAWEGKQVHDYLLKLGFESQI 345

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
++++LVDMYAKC S+ +AR FD P +V WT+++ GYV G +E+AL+L M+ E
Sbjct: 346 YVMTALVDMYAKCSSIVDARKGFDYLQEPDIVLWTSMIGGYVQNGENEDALSLYGRMEME 405

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ + + A L AC S +++ + +HA +K G+ +++ +GS L YAKCG + +
Sbjct: 406 GILPNELTMASVLKACSSLAALEQGKQIHARTVKYGFGLEVPIGSALSTMYAKCGCLKDG 465

Query: 13 QDVF 2
VF
Sbjct: 466 TLVF 469



Score = 92.8 bits (229), Expect = 1e-17
Identities = 48/138 (34%), Positives = 74/138 (53%)
Frame = -3

Query: 535 EHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSL 356
E + M+++G+ PN ++ L++CS +AL +G +H V+ GF + I S+L
Sbjct: 393 EDALSLYGRMEMEGILPNELTMASVLKACSSLAALEQGKQIHARTVKYGFGLEVPIGSAL 452

Query: 355 VDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDA 176
MYAKCG L + VF R +++W A+++G G +EAL L E MQ EG D
Sbjct: 453 STMYAKCGCLKDGTLVFRRMPARDVISWNAMISGLSQNGCGKEALELFEEMQLEGTKPDY 512

Query: 175 VMYACSLNACGSSRQVDR 122
V + L+AC V+R
Sbjct: 513 VTFVNILSACSHMGLVER 530



Score = 89.7 bits (221), Expect = 9e-17
Identities = 50/169 (29%), Positives = 85/169 (50%)
Frame = -3

Query: 508 MQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGS 329
M+ + N + L + + +N G +H V+ G + + ++LV MYAKCGS
Sbjct: 200 MRREEEGENEFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGS 259

Query: 328 LAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNA 149
L +A F+ +S + W+A++ G G ++AL L +M G+ + +NA
Sbjct: 260 LDDALQTFETSSDKNSITWSAMITGXAQSGDSDKALKLFSSMHLSGIRPSEFTFVGVINA 319

Query: 148 CGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
C + +H +LK G++ +YV + LVD YAKC S+V+A+ F
Sbjct: 320 CSDLGAAWEGKQVHDYLLKLGFESQIYVMTALVDMYAKCSSIVDARKGF 368



Score = 79.3 bits (194), Expect = 1e-13
Identities = 49/164 (29%), Positives = 84/164 (51%), Gaps = 2/164 (1%)
Frame = -3

Query: 487 PNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEARFV 308
P+ S+ AL + + +L +G LH +++++ I +SLV++YAKC L EA+FV
Sbjct: 4 PSNRSFFTALLQYTHNRSLQKGKALHAQIIKSSSSC-VYIANSLVNLYAKCQRLREAKFV 62

Query: 307 FDRTSTPALVAWTALMAGYVDYG--FDEEALNLLETMQSEGLCLDAVMYACSLNACGSSR 134
F+R +V+W ++ GY +G + L + M++E +A +A A +
Sbjct: 63 FERIQNKDVVSWNCIINGYSQHGPSGSSHVMELFQRMRAENTAPNAHTFAGVFTAASTLV 122

Query: 133 QVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ HA +K D++VGS L++ Y K G EA+ VF
Sbjct: 123 DAAGGRLAHAVAIKMDSCRDVFVGSSLMNMYCKAGLTPEARKVF 166



Score = 79.0 bits (193), Expect = 2e-13
Identities = 51/179 (28%), Positives = 81/179 (45%)
Frame = -3

Query: 538 AEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISS 359
+ H ++ M+ + APNA ++ + S G H ++ D + SS
Sbjct: 89 SSHVMELFQRMRAENTAPNAHTFAGVFTAASTLVDAAGGRLAHAVAIKMDSCRDVFVGSS 148

Query: 358 LVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLD 179
L++MY K G EAR VFD V+W +++GY EAL L M+ E +
Sbjct: 149 LMNMYCKAGLTPEARKVFDTMPERNSVSWATMISGYASQKLAAEALGLFRLMRREEEGEN 208

Query: 178 AVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++ L+A V+ + +H +K G + VG+ LV YAKCGS+ +A F
Sbjct: 209 EFVFTSVLSALTLPELVNNGKQIHCIAVKNGLLSIVSVGNALVTMYAKCGSLDDALQTF 267



Score = 42.4 bits (98), Expect = 0.017
Identities = 22/81 (27%), Positives = 42/81 (51%), Gaps = 2/81 (2%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
+ GC + ++ EMQL+G P+ V+++ L +CS + G + ++ F DP
Sbjct: 488 SQNGCGKEALELFEEMQLEGTKPDYVTFVNILSACSHMGLVERGWG-YFRMMFDEFGMDP 546

Query: 373 CI--ISSLVDMYAKCGSLAEA 317
+ + +VD+ ++ G L EA
Sbjct: 547 RVEHYACMVDILSRAGKLKEA 567


>tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154890 PE=4 SV=1
Length = 922

Score = 131 bits (330), Expect = 2e-29
Identities = 66/165 (40%), Positives = 100/165 (60%)
Frame = -3

Query: 496 GVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAEA 317
G PN VS+ L +C+ + L +GL LH + +AG + + + ++L+ MYA+CGSLA A
Sbjct: 248 GTQPNKVSFASILGACTNPNDLEQGLKLHAYIKQAGLEQEVLVGNALISMYARCGSLANA 307

Query: 316 RFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSS 137
R VFD +P V+W A++AGY + GF EEA L MQ +G D YA L C
Sbjct: 308 RQVFDNLRSPNRVSWNAMIAGYGE-GFMEEAFRLFRDMQQKGFQPDRFTYASLLAICADR 366

Query: 136 RQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++R + LH++I++ ++ D+ V + L+ YAKCGS+ EA+ VF
Sbjct: 367 ADLNRGKELHSQIVRTAWEADVTVATALISMYAKCGSLEEARKVF 411



Score = 123 bits (309), Expect = 6e-27
Identities = 61/181 (33%), Positives = 104/181 (57%)
Frame = -3

Query: 544 GCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCII 365
G + + +MQ +G+ PN S+I L +C L G +H + +AG+++D +
Sbjct: 131 GRGQEAVDLFYQMQREGLKPNQNSFISILSACQTPIVLEFGEQIHSHITKAGYESDVNVS 190

Query: 364 SSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLC 185
++L++MY KCGSL AR VF+ +V+WTA+++GYV +G +EA L + + G
Sbjct: 191 TALINMYCKCGSLELARKVFNEMRERNVVSWTAMISGYVQHGDSKEAFVLFQKLIRSGTQ 250

Query: 184 LDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDV 5
+ V +A L AC + +++ LHA I + G + ++ VG+ L+ YA+CGS+ A+ V
Sbjct: 251 PNKVSFASILGACTNPNDLEQGLKLHAYIKQAGLEQEVLVGNALISMYARCGSLANARQV 310

Query: 4 F 2
F
Sbjct: 311 F 311



Score = 118 bits (296), Expect = 2e-25
Identities = 58/182 (31%), Positives = 102/182 (56%)
Frame = -3

Query: 547 KGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCI 368
+G E + +MQ +G P+ +Y L C+ + LN G LH ++VR ++AD +
Sbjct: 331 EGFMEEAFRLFRDMQQKGFQPDRFTYASLLAICADRADLNRGKELHSQIVRTAWEADVTV 390

Query: 367 ISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGL 188
++L+ MYAKCGSL EAR VF++ V+W A +A +G ++EA + + M+ + +
Sbjct: 391 ATALISMYAKCGSLEEARKVFNQMPEKNAVSWNAFIACCCRHGSEKEAFQVFKQMRRDDV 450

Query: 187 CLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQD 8
D V + LN+C S +R +++H +I + G + V + L+ Y +CG + +A++
Sbjct: 451 IPDHVTFITLLNSCTSPEDFERGRYIHGKIDQWGMLSNNLVANALISMYGRCGKLADARE 510

Query: 7 VF 2
VF
Sbjct: 511 VF 512



Score = 108 bits (269), Expect = 2e-22
Identities = 56/166 (33%), Positives = 95/166 (57%)
Frame = -3

Query: 499 QGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAE 320
+GV N Y L+ C ++ +L EG +H + A F+ D + + L+ MY+KCGS+ +
Sbjct: 45 RGVQANLNFYARRLQECVQAKSLAEGKKVHDHMRSAQFEPDIYLNNMLISMYSKCGSIED 104

Query: 319 ARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGS 140
A VF +V+W A+++GY +G +EA++L MQ EGL + + L+AC +
Sbjct: 105 ANNVFQSMEDKDVVSWNAMISGYALHGRGQEAVDLFYQMQREGLKPNQNSFISILSACQT 164

Query: 139 SRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++ + +H+ I K GY+ D+ V + L++ Y KCGS+ A+ VF
Sbjct: 165 PIVLEFGEQIHSHITKAGYESDVNVSTALINMYCKCGSLELARKVF 210



Score = 102 bits (255), Expect = 1e-20
Identities = 56/185 (30%), Positives = 97/185 (52%), Gaps = 5/185 (2%)
Frame = -3

Query: 541 CAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDAD 377
C HG + +M+ V P+ V++I L SC+ G ++HG++ + G ++
Sbjct: 429 CCRHGSEKEAFQVFKQMRRDDVIPDHVTFITLLNSCTSPEDFERGRYIHGKIDQWGMLSN 488

Query: 376 PCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQS 197
+ ++L+ MY +CG LA+AR VF R L +W A++A YV +G + A +L +S
Sbjct: 489 NLVANALISMYGRCGKLADAREVFYRIRRRDLGSWNAMIAAYVQHGANGSAFDLFIKYKS 548

Query: 196 EGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVE 17
EG D + L A + +D + +H + K G + D+ + + L+ Y+KCGS+ +
Sbjct: 549 EGGKGDKYTFINVLRAIANLEDLDAGRKIHGLVEKAGLEKDIRILTTLIKMYSKCGSLRD 608

Query: 16 AQDVF 2
A VF
Sbjct: 609 AYSVF 613



Score = 85.9 bits (211), Expect = 1e-15
Identities = 45/164 (27%), Positives = 84/164 (51%)
Frame = -3

Query: 499 QGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAE 320
+G + ++I LR+ + L+ G +HG + +AG + D I+++L+ MY+KCGSL +
Sbjct: 549 EGGKGDKYTFINVLRAIANLEDLDAGRKIHGLVEKAGLEKDIRILTTLIKMYSKCGSLRD 608

Query: 319 ARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGS 140
A VF +V W A++A Y ++AL L + M+ EG+ D+ Y LNAC
Sbjct: 609 AYSVFKNVQEKDVVCWNAMLAAYNHSDHGQDALKLFQQMRLEGVNPDSATYTSVLNACAR 668

Query: 139 SRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQD 8
++ + H ++ + + D + +V + + EA++
Sbjct: 669 LGAIEHGKKFHTQLKEAAMETDTRHYACMVAALGRASLLKEAEE 712



Score = 47.8 bits (112), Expect = 4e-04
Identities = 26/97 (26%), Positives = 49/97 (50%), Gaps = 4/97 (4%)
Frame = -3

Query: 538 AEHG---IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCI 368
++HG +K +M+L+GV P++ +Y L +C+R A+ G H +L A + D
Sbjct: 634 SDHGQDALKLFQQMRLEGVNPDSATYTSVLNACARLGAIEHGKKFHTQLKEAAMETDTRH 693

Query: 367 ISSLVDMYAKCGSLAEA-RFVFDRTSTPALVAWTALM 260
+ +V + L EA F+ + +S + W +L+
Sbjct: 694 YACMVAALGRASLLKEAEEFIEEISSESDALMWESLL 730



Score = 41.2 bits (95), Expect = 0.037
Identities = 17/71 (23%), Positives = 39/71 (54%)
Frame = -3

Query: 214 LETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAK 35
++ + G+ + YA L C ++ + + +H + ++ D+Y+ ++L+ Y+K
Sbjct: 39 VQLLGKRGVQANLNFYARRLQECVQAKSLAEGKKVHDHMRSAQFEPDIYLNNMLISMYSK 98

Query: 34 CGSVVEAQDVF 2
CGS+ +A +VF
Sbjct: 99 CGSIEDANNVF 109


>tr|A9U4W7|A9U4W7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_156474 PE=4 SV=1
Length = 908

Score = 130 bits (328), Expect = 4e-29
Identities = 63/184 (34%), Positives = 110/184 (59%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A+ G AE +K S+M+ +G PN ++Y+ L++C +L G +H ++++GF +D
Sbjct: 6 AEYGYAEDAMKVYSQMRREGGQPNEITYLSILKACCSPVSLKWGKKIHAHIIQSGFQSDV 65

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV+MY KCGS+ +A+ +FD+ +++WT ++ G YG +EA + MQ E
Sbjct: 66 RVETALVNMYVKCGSIDDAQLIFDKMVERNVISWTVMIGGLAHYGRGQEAFHRFLQMQRE 125

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G ++ Y LNA S+ ++ V+ +H+ + G +DL VG+ LV YAK GS+ +A
Sbjct: 126 GFIPNSYTYVSILNANASAGALEWVKEVHSHAVNAGLALDLRVGNALVHMYAKSGSIDDA 185

Query: 13 QDVF 2
+ VF
Sbjct: 186 RVVF 189



Score = 107 bits (268), Expect = 3e-22
Identities = 61/184 (33%), Positives = 96/184 (52%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A + C + +M+ +G P+A +++ L + AL +H + AG D
Sbjct: 412 AQQKCGREALSLFLQMRREGFFPDATTFVNILSANVGEEALEWVKEVHSYAIDAGL-VDL 470

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV MYAKCG+ A+ VFD + WT +++G +G EA +L M E
Sbjct: 471 RVGNALVHMYAKCGNTMYAKQVFDDMVERNVTTWTVMISGLAQHGCGHEAFSLFLQMLRE 530

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ DA Y L+AC S+ ++ V+ +H+ + G DL VG+ LV YAKCGSV +A
Sbjct: 531 GIVPDATTYVSILSACASTGALEWVKEVHSHAVNAGLVSDLRVGNALVHMYAKCGSVDDA 590

Query: 13 QDVF 2
+ VF
Sbjct: 591 RRVF 594



Score = 103 bits (258), Expect = 5e-21
Identities = 62/188 (32%), Positives = 96/188 (51%), Gaps = 7/188 (3%)
Frame = -3

Query: 544 GCAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSS--ALNEGLHLHGELVRAGF 386
G A+HG +M+ G PN +Y+ L + + +S AL +H +AGF
Sbjct: 206 GLAQHGRGQEAFSLFLQMERGGCLPNLTTYLSILNASAITSTGALEWVKEVHKHAGKAGF 265

Query: 385 DADPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLET 206
+D + ++L+ MYAKCGS+ +AR VFD +++W A++ G G EA +
Sbjct: 266 ISDLRVGNALIHMYAKCGSIDDARLVFDGMCDRDVISWNAMIGGLAQNGCGHEAFTIFLK 325

Query: 205 MQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGS 26
MQ EG D+ Y LN S+ + V+ +H ++ G DL VGS V Y +CGS
Sbjct: 326 MQQEGFVPDSTTYLSLLNTHVSTGAWEWVKEVHKHAVEVGLVSDLRVGSAFVHMYIRCGS 385

Query: 25 VVEAQDVF 2
+ +AQ +F
Sbjct: 386 IDDAQLIF 393



Score = 102 bits (254), Expect = 1e-20
Identities = 59/172 (34%), Positives = 93/172 (54%), Gaps = 2/172 (1%)
Frame = -3

Query: 511 EMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCG 332
+MQ +G PN+ +Y+ L + + + AL +H V AG D + ++LV MYAK G
Sbjct: 121 QMQREGFIPNSYTYVSILNANASAGALEWVKEVHSHAVNAGLALDLRVGNALVHMYAKSG 180

Query: 331 SLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLN 152
S+ +AR VFD + +WT ++ G +G +EA +L M+ G + Y LN
Sbjct: 181 SIDDARVVFDGMVERDIFSWTVMIGGLAQHGRGQEAFSLFLQMERGGCLPNLTTYLSILN 240

Query: 151 ACG--SSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
A S+ ++ V+ +H K G+ DL VG+ L+ YAKCGS+ +A+ VF
Sbjct: 241 ASAITSTGALEWVKEVHKHAGKAGFISDLRVGNALIHMYAKCGSIDDARLVF 292



Score = 99.8 bits (247), Expect = 9e-20
Identities = 55/184 (29%), Positives = 92/184 (50%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A GC +MQ +G P++ +Y+ L + + A +H V G +D
Sbjct: 311 AQNGCGHEAFTIFLKMQQEGFVPDSTTYLSLLNTHVSTGAWEWVKEVHKHAVEVGLVSDL 370

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ S+ V MY +CGS+ +A+ +FD+ + + W A++ G EAL+L M+ E
Sbjct: 371 RVGSAFVHMYIRCGSIDDAQLIFDKLAVRNVTTWNAMIGGVAQQKCGREALSLFLQMRRE 430

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G DA + L+A ++ V+ +H+ + G +DL VG+ LV YAKCG+ + A
Sbjct: 431 GFFPDATTFVNILSANVGEEALEWVKEVHSYAIDAGL-VDLRVGNALVHMYAKCGNTMYA 489

Query: 13 QDVF 2
+ VF
Sbjct: 490 KQVF 493



Score = 91.7 bits (226), Expect = 2e-17
Identities = 52/182 (28%), Positives = 91/182 (50%), Gaps = 1/182 (0%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A GC +M +G+ P+A +Y+ L +C+ + AL +H V AG +D
Sbjct: 512 AQHGCGHEAFSLFLQMLREGIVPDATTYVSILSACASTGALEWVKEVHSHAVNAGLVSDL 571

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV MYAKCGS+ +AR VFD + +WT ++ G +G +AL+L M+ E
Sbjct: 572 RVGNALVHMYAKCGSVDDARRVFDDMLERDVYSWTVMIGGLAQHGRGLDALDLFVKMKLE 631

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKE-GYKIDLYVGSVLVDCYAKCGSVVE 17
G + + L+AC + VD + + ++ G + + + +VD + G + E
Sbjct: 632 GFKPNGYSFVAVLSACSHAGLVDEGRRQFLSLTQDYGIEPTMEHYTCMVDLLGRAGQLEE 691

Query: 16 AQ 11
A+
Sbjct: 692 AK 693



Score = 64.3 bits (155), Expect = 4e-09
Identities = 30/88 (34%), Positives = 53/88 (60%)
Frame = -3

Query: 265 LMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEG 86
++ GY +YG+ E+A+ + M+ EG + + Y L AC S + + +HA I++ G
Sbjct: 1 MIGGYAEYGYAEDAMKVYSQMRREGGQPNEITYLSILKACCSPVSLKWGKKIHAHIIQSG 60

Query: 85 YKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
++ D+ V + LV+ Y KCGS+ +AQ +F
Sbjct: 61 FQSDVRVETALVNMYVKCGSIDDAQLIF 88


>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 129 bits (324), Expect = 1e-28
Identities = 60/171 (35%), Positives = 108/171 (63%)
Frame = -3

Query: 514 SEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKC 335
+ MQ++G+ PN+++ + L +C+ AL +G +HG +R+GF+++ + ++LV+MYAKC
Sbjct: 311 NRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKC 370

Query: 334 GSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSL 155
G++ A +F+R +VAW A+++GY +G EAL L MQ++G+ D+ L
Sbjct: 371 GNVNSAYKLFERMPKKNVVAWNAIISGYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVL 430

Query: 154 NACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
AC +++ + +H ++ G++ ++ VG+ LVD YAKCG+V AQ +F
Sbjct: 431 PACAHFLALEQGKQIHGYTIRSGFESNVVVGTGLVDIYAKCGNVNTAQKLF 481



Score = 111 bits (277), Expect = 3e-23
Identities = 55/184 (29%), Positives = 99/184 (53%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
+ G + SEMQ+ G+ PN+ + + + C+ AL +G +H +R+G ++D
Sbjct: 197 SQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGIESDV 256

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+++ LV+MYAKCG++ A +F+R + +W A++ GY EAL MQ
Sbjct: 257 LVVNGLVNMYAKCGNVNTAHKLFERMPIRDVASWNAIIGGYSLNSQHHEALAFFNRMQVR 316

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G+ +++ L AC +++ Q +H ++ G++ + VG+ LV+ YAKCG+V A
Sbjct: 317 GIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFESNDVVGNALVNMYAKCGNVNSA 376

Query: 13 QDVF 2
+F
Sbjct: 377 YKLF 380



Score = 109 bits (273), Expect = 9e-23
Identities = 55/170 (32%), Positives = 94/170 (55%)
Frame = -3

Query: 511 EMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCG 332
+MQ G+ P+ + ++ +++C S L G +H +++ GF++D + ++L MY KCG
Sbjct: 110 QMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHEDIIARGFESDVIVGTALASMYTKCG 169

Query: 331 SLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLN 152
SL AR VFDR +V+W A++AGY G EAL L MQ G+ ++ +
Sbjct: 170 SLENARQVFDRMPKRDVVSWNAIIAGYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMP 229

Query: 151 ACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
C +++ + +H ++ G + D+ V + LV+ YAKCG+V A +F
Sbjct: 230 VCAHLLALEQGKQIHCYAIRSGIESDVLVVNGLVNMYAKCGNVNTAHKLF 279



Score = 103 bits (257), Expect = 6e-21
Identities = 58/186 (31%), Positives = 99/186 (53%), Gaps = 6/186 (3%)
Frame = -3

Query: 544 GCAEHG-----IKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDA 380
G ++HG + EMQ QG+ P++ + + L +C+ AL +G +HG +R+GF++
Sbjct: 397 GYSQHGHPHEALALFIEMQAQGIKPDSFAIVSVLPACAHFLALEQGKQIHGYTIRSGFES 456

Query: 379 DPCIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQ 200
+ + + LVD+YAKCG++ A+ +F+R +V+WT ++ Y +G E+AL L MQ
Sbjct: 457 NVVVGTGLVDIYAKCGNVNTAQKLFERMPEQDVVSWTTMILAYGIHGHGEDALALFSKMQ 516

Query: 199 SEGLCLDAVMYACSLNACGSSRQVDR-VQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSV 23
G LD + + L AC + VD+ +Q+ G L + LVD + G +
Sbjct: 517 ETGTKLDHIAFTAILTACSHAGLVDQGLQYFQCMKSDYGLAPKLEHYACLVDLLGRAGHL 576

Query: 22 VEAQDV 5
EA +
Sbjct: 577 DEANGI 582



Score = 69.3 bits (168), Expect = 1e-10
Identities = 33/93 (35%), Positives = 51/93 (54%)
Frame = -3

Query: 280 VAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGSSRQVDRVQHLHAE 101
V W + GYV GF +AL L MQ G+ D +++ + ACGS + + +H +
Sbjct: 86 VVWKETIIGYVKNGFWNKALRLYYQMQRTGINPDKLVFLSVIKACGSQSDLQAGRKVHED 145

Query: 100 ILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
I+ G++ D+ VG+ L Y KCGS+ A+ VF
Sbjct: 146 IIARGFESDVIVGTALASMYTKCGSLENARQVF 178


>tr|A9TDA2|A9TDA2_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169414 PE=4 SV=1
Length = 703

Score = 129 bits (324), Expect = 1e-28
Identities = 64/184 (34%), Positives = 107/184 (58%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A G + + + +M+ +G PNA++Y+ L +C+ AL +H + AG + D
Sbjct: 206 AQSGNGKEAYRLMLQMEQEGFKPNAITYVSILNACASEGALKWVKRVHRHALDAGLELDV 265

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV MYAK GS+ +AR VFDR +V+W ++ + ++G EA +L MQ+E
Sbjct: 266 RVGTALVQMYAKSGSIDDARVVFDRMKVRDVVSWNVMIGAFAEHGRGHEAYDLFLQMQTE 325

Query: 193 GLCLDAVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEA 14
G DA+M+ LNAC S+ ++ V+ +H L G ++D+ VG+ LV Y+K GS+ +A
Sbjct: 326 GCKPDAIMFLSILNACASAGALEWVKKIHRHALDSGLEVDVRVGTALVHMYSKSGSIDDA 385

Query: 13 QDVF 2
+ VF
Sbjct: 386 RVVF 389



Score = 125 bits (315), Expect = 1e-27
Identities = 65/179 (36%), Positives = 103/179 (57%)
Frame = -3

Query: 538 AEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISS 359
AE ++ EM +GV PNA +Y+ L++C+ SAL G +H + G ++D + ++
Sbjct: 110 AEDAMRLFREMCHEGVQPNAGTYMIILKACASLSALKWGKEVHACIRHGGLESDVRVGTA 169

Query: 358 LVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLD 179
L+ MY KCGS+ EAR +FD +++WT ++ Y G +EA L+ M+ EG +
Sbjct: 170 LLRMYGKCGSINEARRIFDNLMNHDIISWTVMIGAYAQSGNGKEAYRLMLQMEQEGFKPN 229

Query: 178 AVMYACSLNACGSSRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
A+ Y LNAC S + V+ +H L G ++D+ VG+ LV YAK GS+ +A+ VF
Sbjct: 230 AITYVSILNACASEGALKWVKRVHRHALDAGLELDVRVGTALVQMYAKSGSIDDARVVF 288



Score = 100 bits (250), Expect = 4e-20
Identities = 52/166 (31%), Positives = 93/166 (56%)
Frame = -3

Query: 499 QGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADPCIISSLVDMYAKCGSLAE 320
+G+ ++ Y+E L+ C + L +H ++++ + + ++++L+ +Y +CG L E
Sbjct: 22 RGLITDSFMYVEVLKRCLKQKDLMAAKQVHDCIIKSRMEQNAHVMNNLLHVYIECGRLQE 81

Query: 319 ARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSEGLCLDAVMYACSLNACGS 140
AR VFD + +W A++AGYV++ E+A+ L M EG+ +A Y L AC S
Sbjct: 82 ARCVFDALVKKSGASWNAMIAGYVEHKHAEDAMRLFREMCHEGVQPNAGTYMIILKACAS 141

Query: 139 SRQVDRVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVVEAQDVF 2
+ + +HA I G + D+ VG+ L+ Y KCGS+ EA+ +F
Sbjct: 142 LSALKWGKEVHACIRHGGLESDVRVGTALLRMYGKCGSINEARRIF 187



Score = 94.0 bits (232), Expect = 5e-18
Identities = 54/183 (29%), Positives = 97/183 (53%), Gaps = 2/183 (1%)
Frame = -3

Query: 553 ADKGCAEHGIKCLSEMQLQGVAPNAVSYIEALRSCSRSSALNEGLHLHGELVRAGFDADP 374
A+ G +MQ +G P+A+ ++ L +C+ + AL +H + +G + D
Sbjct: 307 AEHGRGHEAYDLFLQMQTEGCKPDAIMFLSILNACASAGALEWVKKIHRHALDSGLEVDV 366

Query: 373 CIISSLVDMYAKCGSLAEARFVFDRTSTPALVAWTALMAGYVDYGFDEEALNLLETMQSE 194
+ ++LV MY+K GS+ +AR VFDR +V+W A+++G +G ++AL + M +
Sbjct: 367 RVGTALVHMYSKSGSIDDARVVFDRMKVRNVVSWNAMISGLAQHGLGQDALEVFRRMTAH 426

Query: 193 GLCLDAVMYACSLNACGSSRQVD--RVQHLHAEILKEGYKIDLYVGSVLVDCYAKCGSVV 20
G+ D V + L+AC + VD R Q+L A G + D+ + +VD + G ++
Sbjct: 427 GVKPDRVTFVAVLSACSHAGLVDEGRSQYL-AMTQVYGIEPDVSHCNCMVDLLGRAGRLM 485

Query: 19 EAQ 11
EA+
Sbjct: 486 EAK 488