BP919264
Clone id YMU001_000123_B01
Library
Length 268
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000123_B01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TGAAAAAATGATGTTGATGGTGGAAGAGATGAAAGCGTGCAACTGTGCACCAGACATTGT
GACTTGGAACACGTTGTAGAATTCTTTTTCCCAGCATGGTCTGCACTCTCAGGTCACTCA
AGTGTTTGAAGACATGAGAAGGGTTGGGCATGAGCCTGACAATAGCACGTTCAATATCCT
CATTGAAACCTATGGCAGATTAGGTTCAGCAGAACAGGCACTGGGAGTCTATAAAGCCAT
GCTCAGAGCTAGTTGCTGTCCTGACATA
■■Homology search results ■■ -
sp_hit_id Q9LYZ9
Definition sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein At5g02860 OS=Arabidopsis thaliana
Align length 88
Score (bit) 92.4
E-value 6.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919264|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_B01.
(268 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protei... 92 6e-19
sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protei... 68 1e-11
sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protei... 60 3e-09
sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protei... 59 8e-09
sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protei... 56 5e-08
sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protei... 56 5e-08
sp|Q9LUJ4|PP248_ARATH Pentatricopeptide repeat-containing protei... 56 5e-08
sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protei... 55 8e-08
sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protei... 55 8e-08
sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protei... 55 1e-07
sp|Q9ZUE9|PP149_ARATH Pentatricopeptide repeat-containing protei... 55 1e-07
sp|Q9MAG8|PPR79_ARATH Putative pentatricopeptide repeat-containi... 55 1e-07
sp|Q9FMQ1|PP376_ARATH Pentatricopeptide repeat-containing protei... 55 1e-07
sp|Q9SZ52|PP344_ARATH Pentatricopeptide repeat-containing protei... 55 1e-07
sp|Q9SHK2|PPR17_ARATH Pentatricopeptide repeat-containing protei... 54 2e-07
sp|Q8S9D1|PP395_ARATH Pentatricopeptide repeat-containing protei... 54 2e-07
sp|Q9SSF9|PP123_ARATH Pentatricopeptide repeat-containing protei... 54 2e-07
sp|Q9LS25|PP420_ARATH Pentatricopeptide repeat-containing protei... 54 3e-07
sp|Q9ZVX5|PP156_ARATH Pentatricopeptide repeat-containing protei... 54 3e-07
sp|Q8GWE0|PP314_ARATH Pentatricopeptide repeat-containing protei... 53 4e-07
sp|Q9M9X9|PPR18_ARATH Pentatricopeptide repeat-containing protei... 53 5e-07
sp|Q9S7R4|PP125_ARATH Pentatricopeptide repeat-containing protei... 53 5e-07
sp|Q3E9F0|PP392_ARATH Pentatricopeptide repeat-containing protei... 52 7e-07
sp|Q0WVK7|PPR12_ARATH Pentatricopeptide repeat-containing protei... 52 9e-07
sp|Q8RWS8|PP199_ARATH Pentatricopeptide repeat-containing protei... 52 9e-07
sp|Q8GYP6|PPR49_ARATH Pentatricopeptide repeat-containing protei... 52 1e-06
sp|Q8L844|PP413_ARATH Pentatricopeptide repeat-containing protei... 52 1e-06
sp|Q9LKU8|PP401_ARATH Pentatricopeptide repeat-containing protei... 51 2e-06
sp|Q8VZE4|PP299_ARATH Pentatricopeptide repeat-containing protei... 51 2e-06
sp|Q9M316|PP292_ARATH Pentatricopeptide repeat-containing protei... 51 2e-06

>sp|Q9LYZ9|PP362_ARATH Pentatricopeptide repeat-containing protein
At5g02860 OS=Arabidopsis thaliana GN=At5g02860 PE=2 SV=1
Length = 819

Score = 92.4 bits (228), Expect = 6e-19
Identities = 43/88 (48%), Positives = 59/88 (67%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+MM + +E+ C +PDIVTWNTL F Q+G+ S+V+ VF++M+R G P+ TFN LI
Sbjct: 437 EMMKIFDEINVCGLSPDIVTWNTLLAVFGQNGMDSEVSGVFKEMKRAGFVPERETFNTLI 496

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
Y R GS EQA+ VY+ ML A PD+
Sbjct: 497 SAYSRCGSFEQAMTVYRRMLDAGVTPDL 524



Score = 61.6 bits (148), Expect = 1e-09
Identities = 31/88 (35%), Positives = 48/88 (54%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
K+ +VE+MK+ APD T+NTL + LH + QVFE+M+ G D T+N L+
Sbjct: 262 KITSLVEKMKSDGIAPDAYTYNTLITCCKRGSLHQEAAQVFEEMKAAGFSYDKVTYNALL 321

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ YG+ ++A+ V M+ P I
Sbjct: 322 DVYGKSHRPKEAMKVLNEMVLNGFSPSI 349



Score = 54.3 bits (129), Expect = 2e-07
Identities = 25/89 (28%), Positives = 50/89 (56%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++ M ++ EM +P IVT+N+L +++++ G+ + ++ M G +PD T+ L
Sbjct: 331 KEAMKVLNEMVLNGFSPSIVTYNSLISAYARDGMLDEAMELKNQMAEKGTKPDVFTYTTL 390

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ + R G E A+ +++ M A C P+I
Sbjct: 391 LSGFERAGKVESAMSIFEEMRNAGCKPNI 419



Score = 50.8 bits (120), Expect = 2e-06
Identities = 25/89 (28%), Positives = 43/89 (48%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++ M + +M PD+ T+ TL + F + G +FE+MR G +P+ TFN
Sbjct: 366 DEAMELKNQMAEKGTKPDVFTYTTLLSGFERAGKVESAMSIFEEMRNAGCKPNICTFNAF 425

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I+ YG G + + ++ + PDI
Sbjct: 426 IKMYGNRGKFTEMMKIFDEINVCGLSPDI 454



Score = 50.8 bits (120), Expect = 2e-06
Identities = 24/83 (28%), Positives = 47/83 (56%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ E+ A PDI+++NT+ ++ ++ +++F +MR G PD T+N I +Y
Sbjct: 686 ILREILAKGIKPDIISYNTVIYAYCRNTRMRDASRIFSEMRNSGIVPDVITYNTFIGSYA 745

Query: 197 RLGSAEQALGVYKAMLRASCCPD 265
E+A+GV + M++ C P+
Sbjct: 746 ADSMFEEAIGVVRYMIKHGCRPN 768



Score = 40.4 bits (93), Expect = 0.003
Identities = 17/65 (26%), Positives = 35/65 (53%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EM+ PD++T+NT S++ + + V M + G P+ +T+N +++ Y +L
Sbjct: 724 EMRNSGIVPDVITYNTFIGSYAADSMFEEAIGVVRYMIKHGCRPNQNTYNSIVDGYCKLN 783

Query: 206 SAEQA 220
++A
Sbjct: 784 RKDEA 788



Score = 40.0 bits (92), Expect = 0.004
Identities = 23/77 (29%), Positives = 41/77 (53%), Gaps = 1/77 (1%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLH-SQVTQVFEDMRRVGHEPDNSTFNILIETYGR 199
++M+ C P ++T+N + N F + G +++T + E M+ G PD T+N LI R
Sbjct: 232 KKMEEDGCKPTLITYNVILNVFGKMGTPWNKITSLVEKMKSDGIAPDAYTYNTLITCCKR 291

Query: 200 LGSAEQALGVYKAMLRA 250
++A V++ M A
Sbjct: 292 GSLHQEAAQVFEEMKAA 308



Score = 35.4 bits (80), Expect = 0.090
Identities = 19/81 (23%), Positives = 40/81 (49%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
E+K +PDI T N++ + + + + ++ V + M+ G P +T+N L+ + R
Sbjct: 619 ELKERGFSPDITTLNSMVSIYGRRQMVAKANGVLDYMKERGFTPSMATYNSLMYMHSRSA 678

Query: 206 SAEQALGVYKAMLRASCCPDI 268
++ + + +L PDI
Sbjct: 679 DFGKSEEILREILAKGIKPDI 699



Score = 33.9 bits (76), Expect = 0.26
Identities = 23/87 (26%), Positives = 37/87 (42%)
Frame = +2

Query: 8 MMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIE 187
M + EE+ + P V TL S+ L + + F +++ G PD +T N ++
Sbjct: 578 MHSLAEEVYSGVIEPRAVLLKTLVLVCSKCDLLPEAERAFSELKERGFSPDITTLNSMVS 637

Query: 188 TYGRLGSAEQALGVYKAMLRASCCPDI 268
YGR +A GV M P +
Sbjct: 638 IYGRRQMVAKANGVLDYMKERGFTPSM 664



Score = 32.7 bits (73), Expect = 0.58
Identities = 18/84 (21%), Positives = 38/84 (45%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++ MK P + T+N+L S+ + ++ ++ G +PD ++N +I Y
Sbjct: 651 VLDYMKERGFTPSMATYNSLMYMHSRSADFGKSEEILREILAKGIKPDIISYNTVIYAYC 710

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R A ++ M + PD+
Sbjct: 711 RNTRMRDASRIFSEMRNSGIVPDV 734



Score = 30.8 bits (68), Expect = 2.2
Identities = 16/64 (25%), Positives = 31/64 (48%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ M + M PD+ T+NT+ + ++ G+ Q +V +M +P+ T+ L
Sbjct: 506 EQAMTVYRRMLDAGVTPDLSTYNTVLAALARGGMWEQSEKVLAEMEDGRCKPNELTYCSL 565

Query: 182 IETY 193
+ Y
Sbjct: 566 LHAY 569


>sp|O64624|PP163_ARATH Pentatricopeptide repeat-containing protein
At2g18940 OS=Arabidopsis thaliana GN=At2g18940 PE=2 SV=1
Length = 822

Score = 68.2 bits (165), Expect = 1e-11
Identities = 34/82 (41%), Positives = 47/82 (57%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+M+ M+ +MK+ C+P+ TWNT+ G+ V +VF +M+ G EPD TFN LI
Sbjct: 439 EMIKMLCDMKSNGCSPNRATWNTMLALCGNKGMDKFVNRVFREMKSCGFEPDRDTFNTLI 498

Query: 185 ETYGRLGSAEQALGVYKAMLRA 250
YGR GS A +Y M RA
Sbjct: 499 SAYGRCGSEVDASKMYGEMTRA 520



Score = 53.1 bits (126), Expect = 4e-07
Identities = 25/83 (30%), Positives = 47/83 (56%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM+ +C D VT+N L ++ + G + V E M + G P+ T+ +I+ YG
Sbjct: 338 VLKEMEENSCPADSVTYNELVAAYVRAGFSKEAAGVIEMMTKKGVMPNAITYTTVIDAYG 397

Query: 197 RLGSAEQALGVYKAMLRASCCPD 265
+ G ++AL ++ +M A C P+
Sbjct: 398 KAGKEDEALKLFYSMKEAGCVPN 420



Score = 50.8 bits (120), Expect = 2e-06
Identities = 25/87 (28%), Positives = 50/87 (57%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
K++ +++EM++ D T +T+ ++ ++ GL + + F +++ G+EP T+N L+
Sbjct: 264 KILGVLDEMRSKGLKFDEFTCSTVLSACAREGLLREAKEFFAELKSCGYEPGTVTYNALL 323

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPD 265
+ +G+ G +AL V K M SC D
Sbjct: 324 QVFGKAGVYTEALSVLKEMEENSCPAD 350



Score = 50.8 bits (120), Expect = 2e-06
Identities = 24/80 (30%), Positives = 43/80 (53%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
E+K+C P VT+N L F + G++++ V ++M D+ T+N L+ Y R G
Sbjct: 306 ELKSCGYEPGTVTYNALLQVFGKAGVYTEALSVLKEMEENSCPADSVTYNELVAAYVRAG 365

Query: 206 SAEQALGVYKAMLRASCCPD 265
+++A GV + M + P+
Sbjct: 366 FSKEAAGVIEMMTKKGVMPN 385



Score = 45.8 bits (107), Expect = 7e-05
Identities = 21/73 (28%), Positives = 42/73 (57%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD+V +N++ + F+++ ++ Q + E +R G PD T+N L++ Y R G +A +
Sbjct: 629 PDMVIFNSMLSIFTRNNMYDQAEGILESIREDGLSPDLVTYNSLMDMYVRRGECWKAEEI 688

Query: 230 YKAMLRASCCPDI 268
K + ++ PD+
Sbjct: 689 LKTLEKSQLKPDL 701



Score = 41.2 bits (95), Expect = 0.002
Identities = 18/64 (28%), Positives = 39/64 (60%), Gaps = 1/64 (1%)
Frame = +2

Query: 53 DIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG-SAEQALGV 229
D+ + T+ +++S+ G + + +FE M+ +G P T+N++++ +G++G S + LGV
Sbjct: 209 DVRAYTTILHAYSRTGKYEKAIDLFERMKEMGPSPTLVTYNVILDVFGKMGRSWRKILGV 268

Query: 230 YKAM 241
M
Sbjct: 269 LDEM 272



Score = 41.2 bits (95), Expect = 0.002
Identities = 19/83 (22%), Positives = 40/83 (48%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++ ++ PD+V++NT+ F + GL + ++ +M G P T+N + Y
Sbjct: 688 ILKTLEKSQLKPDLVSYNTVIKGFCRRGLMQEAVRMLSEMTERGIRPCIFTYNTFVSGYT 747

Query: 197 RLGSAEQALGVYKAMLRASCCPD 265
+G + V + M + C P+
Sbjct: 748 AMGMFAEIEDVIECMAKNDCRPN 770



Score = 40.0 bits (92), Expect = 0.004
Identities = 19/60 (31%), Positives = 33/60 (55%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EMK+C PD T+NTL +++ + G ++++ +M R G +T+N L+ R G
Sbjct: 481 EMKSCGFEPDRDTFNTLISAYGRCGSEVDASKMYGEMTRAGFNACVTTYNALLNALARKG 540



Score = 37.7 bits (86), Expect = 0.018
Identities = 16/83 (19%), Positives = 40/83 (48%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++E M P+ +T+ T+ +++ + G + ++F M+ G P+ T+N ++ G
Sbjct: 373 VIEMMTKKGVMPNAITYTTVIDAYGKAGKEDEALKLFYSMKEAGCVPNTCTYNAVLSLLG 432

Query: 197 RLGSAEQALGVYKAMLRASCCPD 265
+ + + + + M C P+
Sbjct: 433 KKSRSNEMIKMLCDMKSNGCSPN 455



Score = 35.8 bits (81), Expect = 0.069
Identities = 18/84 (21%), Positives = 45/84 (53%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++E ++ +PD+VT+N+L + + + G + ++ + + + +PD ++N +I+ +
Sbjct: 653 ILESIREDGLSPDLVTYNSLMDMYVRRGECWKAEEILKTLEKSQLKPDLVSYNTVIKGFC 712

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G ++A+ + M P I
Sbjct: 713 RRGLMQEAVRMLSEMTERGIRPCI 736



Score = 32.3 bits (72), Expect = 0.76
Identities = 15/64 (23%), Positives = 32/64 (50%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M EM + T+N L N+ ++ G V DM+ G +P ++++++++ Y
Sbjct: 513 MYGEMTRAGFNACVTTYNALLNALARKGDWRSGENVISDMKSKGFKPTETSYSLMLQCYA 572

Query: 197 RLGS 208
+ G+
Sbjct: 573 KGGN 576


>sp|O82178|PP186_ARATH Pentatricopeptide repeat-containing protein
At2g35130 OS=Arabidopsis thaliana GN=At2g35130 PE=2 SV=1
Length = 591

Score = 60.5 bits (145), Expect = 3e-09
Identities = 28/80 (35%), Positives = 45/80 (56%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EM++ C P+I T+ L N+F++ GL + ++FE ++ G EPD +N L+E+Y R G
Sbjct: 289 EMRSHQCKPNICTYTALVNAFAREGLCEKAEEIFEQLQEDGLEPDVYVYNALMESYSRAG 348

Query: 206 SAEQALGVYKAMLRASCCPD 265
A ++ M C PD
Sbjct: 349 YPYGAAEIFSLMQHMGCEPD 368



Score = 57.4 bits (137), Expect = 2e-08
Identities = 27/87 (31%), Positives = 47/87 (54%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK + E+++ PD+ +N L S+S+ G ++F M+ +G EPD +++NI+
Sbjct: 316 EKAEEIFEQLQEDGLEPDVYVYNALMESYSRAGYPYGAAEIFSLMQHMGCEPDRASYNIM 375

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCP 262
++ YGR G A V++ M R P
Sbjct: 376 VDAYGRAGLHSDAEAVFEEMKRLGIAP 402



Score = 48.1 bits (113), Expect = 1e-05
Identities = 25/87 (28%), Positives = 44/87 (50%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
KM ++ EM+ C DI T+N L N + + G ++ ++F +++ PD T+ I
Sbjct: 457 KMEKILAEMENGPCTADISTYNILINIYGKAGFLERIEELFVELKEKNFRPDVVTWTSRI 516

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPD 265
Y R + L V++ M+ + C PD
Sbjct: 517 GAYSRKKLYVKCLEVFEEMIDSGCAPD 543



Score = 47.4 bits (111), Expect = 2e-05
Identities = 22/79 (27%), Positives = 39/79 (49%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
M+ C PD ++N + +++ + GLHS VFE+M+R+G P + +L+ Y +
Sbjct: 360 MQHMGCEPDRASYNIMVDAYGRAGLHSDAEAVFEEMKRLGIAPTMKSHMLLLSAYSKARD 419

Query: 209 AEQALGVYKAMLRASCCPD 265
+ + K M PD
Sbjct: 420 VTKCEAIVKEMSENGVEPD 438



Score = 46.2 bits (108), Expect = 5e-05
Identities = 24/80 (30%), Positives = 40/80 (50%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E++ + E+K N PD+VTW + ++S+ L+ + +VFE+M G PD T +L
Sbjct: 491 ERIEELFVELKEKNFRPDVVTWTSRIGAYSRKKLYVKCLEVFEEMIDSGCAPDGGTAKVL 550

Query: 182 IETYGRLGSAEQALGVYKAM 241
+ EQ V + M
Sbjct: 551 LSACSSEEQVEQVTSVLRTM 570



Score = 41.6 bits (96), Expect = 0.001
Identities = 23/88 (26%), Positives = 43/88 (48%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
K +V+EM PD N++ N + + G +++ ++ +M D ST+NILI
Sbjct: 422 KCEAIVKEMSENGVEPDTFVLNSMLNLYGRLGQFTKMEKILAEMENGPCTADISTYNILI 481

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
YG+ G E+ ++ + + PD+
Sbjct: 482 NIYGKAGFLERIEELFVELKEKNFRPDV 509



Score = 33.9 bits (76), Expect = 0.26
Identities = 16/57 (28%), Positives = 28/57 (49%)
Frame = +2

Query: 98 GLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVYKAMLRASCCPDI 268
G + VF+ M+R +P T+N++I YG+ + + +Y M C P+I
Sbjct: 243 GNTEEAIDVFQRMKRDRCKPTTETYNLMINLYGKASKSYMSWKLYCEMRSHQCKPNI 299



Score = 29.6 bits (65), Expect = 4.9
Identities = 13/43 (30%), Positives = 24/43 (55%)
Frame = +2

Query: 134 MRRVGHEPDNSTFNILIETYGRLGSAEQALGVYKAMLRASCCP 262
+R+ +PD FN+LI+ YG+ ++A +Y +L + P
Sbjct: 146 LRKSSFQPDVICFNLLIDAYGQKFQYKEAESLYVQLLESRYVP 188


>sp|Q9S7Q2|PP124_ARATH Pentatricopeptide repeat-containing protein
At1g74850, chloroplastic OS=Arabidopsis thaliana
GN=PTAC2 PE=2 SV=1
Length = 862

Score = 58.9 bits (141), Expect = 8e-09
Identities = 28/89 (31%), Positives = 52/89 (58%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++ M + +M+A C P+ T++ L N F Q G + V Q+F +M+ +PD +T+NIL
Sbjct: 334 KEAMGVFHQMQAAGCTPNANTYSVLLNLFGQSGRYDDVRQLFLEMKSSNTDPDAATYNIL 393

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
IE +G G ++ + ++ M+ + PD+
Sbjct: 394 IEVFGEGGYFKEVVTLFHDMVEENIEPDM 422



Score = 53.5 bits (127), Expect = 3e-07
Identities = 30/89 (33%), Positives = 47/89 (52%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E ++ + EM+ PDIVT+NTL ++ + GL + VF M G PD +T++ L
Sbjct: 229 EGLLGLFAEMRHEGIQPDIVTYNTLLSACAIRGLGDEAEMVFRTMNDGGIVPDLTTYSHL 288

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ET+G+L E+ + M PDI
Sbjct: 289 VETFGKLRRLEKVCDLLGEMASGGSLPDI 317



Score = 50.4 bits (119), Expect = 3e-06
Identities = 23/72 (31%), Positives = 42/72 (58%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD+ T++ L +F + +V + +M G PD +++N+L+E Y + GS ++A+GV
Sbjct: 280 PDLTTYSHLVETFGKLRRLEKVCDLLGEMASGGSLPDITSYNVLLEAYAKSGSIKEAMGV 339

Query: 230 YKAMLRASCCPD 265
+ M A C P+
Sbjct: 340 FHQMQAAGCTPN 351



Score = 44.7 bits (104), Expect = 1e-04
Identities = 26/79 (32%), Positives = 36/79 (45%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EMK+ N PD T+N L F + G +V +F DM EPD T+ +I G+ G
Sbjct: 377 EMKSSNTDPDAATYNILIEVFGEGGYFKEVVTLFHDMVEENIEPDMETYEGIIFACGKGG 436

Query: 206 SAEQALGVYKAMLRASCCP 262
E A + + M P
Sbjct: 437 LHEDARKILQYMTANDIVP 455



Score = 41.6 bits (96), Expect = 0.001
Identities = 25/88 (28%), Positives = 42/88 (47%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ ++ M P I T+++L SF++ GL + + + G + TFN
Sbjct: 474 EEALVAFNTMHEVGSNPSIETFHSLLYSFARGGLVKESEAILSRLVDSGIPRNRDTFNAQ 533

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
IE Y + G E+A+ Y M ++ C PD
Sbjct: 534 IEAYKQGGKFEEAVKTYVDMEKSRCDPD 561



Score = 34.7 bits (78), Expect = 0.15
Identities = 22/84 (26%), Positives = 37/84 (44%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
MVEE N PD+ T+ + + + GLH ++ + M P + + +IE +G
Sbjct: 413 MVEE----NIEPDMETYEGIIFACGKGGLHEDARKILQYMTANDIVPSSKAYTGVIEAFG 468

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ E+AL + M P I
Sbjct: 469 QAALYEEALVAFNTMHEVGSNPSI 492



Score = 32.0 bits (71), Expect = 0.99
Identities = 19/75 (25%), Positives = 32/75 (42%)
Frame = +2

Query: 44 CAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQAL 223
C P+ + + + + GL + +VF++M G ++ LI YGR G E +L
Sbjct: 137 CKPNEHIYTIMISLLGREGLLDKCLEVFDEMPSQGVSRSVFSYTALINAYGRNGRYETSL 196

Query: 224 GVYKAMLRASCCPDI 268
+ M P I
Sbjct: 197 ELLDRMKNEKISPSI 211


>sp|Q9ZU27|PPR76_ARATH Pentatricopeptide repeat-containing protein
At1g51965, mitochondrial OS=Arabidopsis thaliana
GN=At1g51965 PE=2 SV=1
Length = 650

Score = 56.2 bits (134), Expect = 5e-08
Identities = 25/84 (29%), Positives = 50/84 (59%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M+ ++ D + +NT+ ++ + S + +FE M++ G PD T+NILI ++G
Sbjct: 429 MLSKIHEKGVVTDTMMYNTVFSALGKLKQISHIHDLFEKMKKDGPSPDIFTYNILIASFG 488

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R+G ++A+ +++ + R+ C PDI
Sbjct: 489 RVGEVDEAINIFEELERSDCKPDI 512



Score = 56.2 bits (134), Expect = 5e-08
Identities = 26/82 (31%), Positives = 48/82 (58%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
EE++ +C PDI+++N+L N ++G + F++M+ G PD T++ L+E +G+
Sbjct: 501 EELERSDCKPDIISYNSLINCLGKNGDVDEAHVRFKEMQEKGLNPDVVTYSTLMECFGKT 560

Query: 203 GSAEQALGVYKAMLRASCCPDI 268
E A +++ ML C P+I
Sbjct: 561 ERVEMAYSLFEEMLVKGCQPNI 582



Score = 49.7 bits (117), Expect = 5e-06
Identities = 27/84 (32%), Positives = 44/84 (52%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+ E+MK +PDI T+N L SF + G + +FE++ R +PD ++N LI G
Sbjct: 464 LFEKMKKDGPSPDIFTYNILIASFGRVGEVDEAINIFEELERSDCKPDIISYNSLINCLG 523

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ G ++A +K M PD+
Sbjct: 524 KNGDVDEAHVRFKEMQEKGLNPDV 547



Score = 45.1 bits (105), Expect = 1e-04
Identities = 24/81 (29%), Positives = 42/81 (51%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+EM+ PD+VT++TL F + +FE+M G +P+ T+NIL++ +
Sbjct: 536 KEMQEKGLNPDVVTYSTLMECFGKTERVEMAYSLFEEMLVKGCQPNIVTYNILLDCLEKN 595

Query: 203 GSAEQALGVYKAMLRASCCPD 265
G +A+ +Y M + PD
Sbjct: 596 GRTAEAVDLYSKMKQQGLTPD 616



Score = 43.1 bits (100), Expect = 4e-04
Identities = 21/64 (32%), Positives = 38/64 (59%)
Frame = +2

Query: 53 DIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVY 232
DI +N L ++ ++ + QVFEDM++ D T+ I+I T GR+G ++A+G++
Sbjct: 237 DIFAYNMLLDALAKD---EKACQVFEDMKKRHCRRDEYTYTIMIRTMGRIGKCDEAVGLF 293

Query: 233 KAML 244
M+
Sbjct: 294 NEMI 297



Score = 40.0 bits (92), Expect = 0.004
Identities = 17/55 (30%), Positives = 32/55 (58%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
+ EEM C P+IVT+N L + ++G ++ ++ M++ G PD+ T+ +L
Sbjct: 569 LFEEMLVKGCQPNIVTYNILLDCLEKNGRTAEAVDLYSKMKQQGLTPDSITYTVL 623


>sp|O65567|PP342_ARATH Pentatricopeptide repeat-containing protein
At4g30825, chloroplastic OS=Arabidopsis thaliana
GN=At4g30825 PE=2 SV=2
Length = 904

Score = 56.2 bits (134), Expect = 5e-08
Identities = 28/88 (31%), Positives = 47/88 (53%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK +++ MK PD T+N + N + + G +V V ++++ G PD ++N L
Sbjct: 785 EKFRSILKRMKKSTSGPDHYTYNIMINIYGEQGWIDEVADVLKELKESGLGPDLCSYNTL 844

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
I+ YG G E+A+G+ K M + PD
Sbjct: 845 IKAYGIGGMVEEAVGLVKEMRGRNIIPD 872



Score = 42.4 bits (98), Expect = 7e-04
Identities = 21/79 (26%), Positives = 41/79 (51%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
M+A +P+I+ +NTL + + +F + +G EPD +++ +IE +GR +
Sbjct: 340 MEAAGFSPNIIAYNTLITGYGKIFKMEAAQGLFHRLCNIGLEPDETSYRSMIEGWGRADN 399

Query: 209 AEQALGVYKAMLRASCCPD 265
E+A Y+ + R P+
Sbjct: 400 YEEAKHYYQELKRCGYKPN 418



Score = 38.9 bits (89), Expect = 0.008
Identities = 21/88 (23%), Positives = 37/88 (42%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
+K +++ MK + W + N++SQ G + M G P+ +N L
Sbjct: 296 DKAEEVIDLMKQDRVRLKLENWLVMLNAYSQQGKMELAESILVSMEAAGFSPNIIAYNTL 355

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
I YG++ E A G++ + PD
Sbjct: 356 ITGYGKIFKMEAAQGLFHRLCNIGLEPD 383



Score = 38.1 bits (87), Expect = 0.014
Identities = 19/87 (21%), Positives = 42/87 (48%)
Frame = +2

Query: 8 MMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIE 187
M ++ M+ + + +NTL +++ + + + + M++ PD+ T+NI+I
Sbjct: 752 MSSAIKNMQFDGFSVSLEAYNTLLDAYGKDKQMEKFRSILKRMKKSTSGPDHYTYNIMIN 811

Query: 188 TYGRLGSAEQALGVYKAMLRASCCPDI 268
YG G ++ V K + + PD+
Sbjct: 812 IYGEQGWIDEVADVLKELKESGLGPDL 838



Score = 34.3 bits (77), Expect = 0.20
Identities = 14/71 (19%), Positives = 39/71 (54%)
Frame = +2

Query: 53 DIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVY 232
D++++NT+ ++ ++ ++ ++ ++M+ G +N L++ YG+ E+ +
Sbjct: 732 DVISYNTIIAAYGKNKDYTNMSSAIKNMQFDGFSVSLEAYNTLLDAYGKDKQMEKFRSIL 791

Query: 233 KAMLRASCCPD 265
K M +++ PD
Sbjct: 792 KRMKKSTSGPD 802



Score = 33.1 bits (74), Expect = 0.45
Identities = 12/30 (40%), Positives = 21/30 (70%)
Frame = +2

Query: 110 QVTQVFEDMRRVGHEPDNSTFNILIETYGR 199
+++ FE+M R G P+ TFN+L++ YG+
Sbjct: 682 ELSGTFEEMIRYGFTPNTVTFNVLLDVYGK 711



Score = 31.6 bits (70), Expect = 1.3
Identities = 15/61 (24%), Positives = 31/61 (50%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++E+K PD+ ++NTL ++ G+ + + ++MR PD T+ L+
Sbjct: 825 VLKELKESGLGPDLCSYNTLIKAYGIGGMVEEAVGLVKEMRGRNIIPDKVTYTNLVTALR 884

Query: 197 R 199
R
Sbjct: 885 R 885



Score = 29.3 bits (64), Expect = 6.4
Identities = 16/64 (25%), Positives = 32/64 (50%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+E+K C P+ TL N +++G + EDM +G + +S I+++ Y ++
Sbjct: 408 QELKRCGYKPNSFNLFTLINLQAKYGDRDGAIKTIEDMTGIGCQ-YSSILGIILQAYEKV 466

Query: 203 GSAE 214
G +
Sbjct: 467 GKID 470


>sp|Q9LUJ4|PP248_ARATH Pentatricopeptide repeat-containing protein
At3g22670, mitochondrial OS=Arabidopsis thaliana
GN=At3g22670 PE=2 SV=1
Length = 562

Score = 56.2 bits (134), Expect = 5e-08
Identities = 26/83 (31%), Positives = 46/83 (55%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M++ MK PD+VT+ + ++ + G +V ++ E+MR G P+ T+ I++ + G
Sbjct: 295 MMDLMKVTEFTPDVVTYTSFVEAYCKEGDFRRVNEMLEEMRENGCNPNVVTYTIVMHSLG 354

Query: 197 RLGSAEQALGVYKAMLRASCCPD 265
+ +ALGVY+ M C PD
Sbjct: 355 KSKQVAEALGVYEKMKEDGCVPD 377



Score = 40.0 bits (92), Expect = 0.004
Identities = 21/84 (25%), Positives = 41/84 (48%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M+EEM+ C P++VT+ + +S + ++ V+E M+ G PD ++ LI
Sbjct: 330 MLEEMRENGCNPNVVTYTIVMHSLGKSKQVAEALGVYEKMKEDGCVPDAKFYSSLIHILS 389

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ G + A +++ M D+
Sbjct: 390 KTGRFKDAAEIFEDMTNQGVRRDV 413



Score = 38.9 bits (89), Expect = 0.008
Identities = 25/85 (29%), Positives = 38/85 (44%), Gaps = 3/85 (3%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
E+MK C PD +++L + S+ G ++FEDM G D +N +I
Sbjct: 367 EKMKEDGCVPDAKFYSSLIHILSKTGRFKDAAEIFEDMTNQGVRRDVLVYNTMISAALHH 426

Query: 203 GSAEQALGVYKAM---LRASCCPDI 268
E AL + K M SC P++
Sbjct: 427 SRDEMALRLLKRMEDEEGESCSPNV 451


>sp|Q9SV96|PP358_ARATH Pentatricopeptide repeat-containing protein
At4g39620, chloroplastic OS=Arabidopsis thaliana
GN=EMB2453 PE=2 SV=1
Length = 563

Score = 55.5 bits (132), Expect = 8e-08
Identities = 31/90 (34%), Positives = 49/90 (54%), Gaps = 1/90 (1%)
Frame = +2

Query: 2 EKMMLMVEEMKACN-CAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNI 178
EK+ +++MK C P++VT+N L +F+Q G QV +F+D+ PD TFN
Sbjct: 189 EKVRGYLDKMKGIERCQPNVVTYNILLRAFAQSGKVDQVNALFKDLDMSPVSPDVYTFNG 248

Query: 179 LIETYGRLGSAEQALGVYKAMLRASCCPDI 268
+++ YG+ G ++ V M C PDI
Sbjct: 249 VMDAYGKNGMIKEMEAVLTRMRSNECKPDI 278



Score = 49.3 bits (116), Expect = 6e-06
Identities = 24/80 (30%), Positives = 45/80 (56%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++M ++ M++ C PDI+T+N L +S+ + ++ Q F+ + R +P TFN +
Sbjct: 260 KEMEAVLTRMRSNECKPDIITFNVLIDSYGKKQEFEKMEQTFKSLMRSKEKPTLPTFNSM 319

Query: 182 IETYGRLGSAEQALGVYKAM 241
I YG+ ++A V+K M
Sbjct: 320 IINYGKARMIDKAEWVFKKM 339



Score = 46.2 bits (108), Expect = 5e-05
Identities = 21/89 (23%), Positives = 52/89 (58%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
+++ + +++ +PD+ T+N + +++ ++G+ ++ V MR +PD TFN+L
Sbjct: 225 DQVNALFKDLDMSPVSPDVYTFNGVMDAYGKNGMIKEMEAVLTRMRSNECKPDIITFNVL 284

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I++YG+ E+ +K+++R+ P +
Sbjct: 285 IDSYGKKQEFEKMEQTFKSLMRSKEKPTL 313



Score = 32.0 bits (71), Expect = 0.99
Identities = 16/53 (30%), Positives = 27/53 (50%), Gaps = 1/53 (1%)
Frame = +2

Query: 110 QVTQVFEDMRRVG-HEPDNSTFNILIETYGRLGSAEQALGVYKAMLRASCCPD 265
Q +VF M++ + PDN ++ LI G+ G A+ ++ M + C PD
Sbjct: 115 QCLEVFRWMQKQRWYIPDNGVYSKLISVMGKKGQTRMAMWLFSEMKNSGCRPD 167



Score = 30.0 bits (66), Expect = 3.8
Identities = 16/68 (23%), Positives = 31/68 (45%)
Frame = +2

Query: 62 TWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVYKAM 241
T N + + ++GL+ + ++F + PD ST+ L + Y + EQ + K M
Sbjct: 385 TLNAMLEVYCRNGLYIEADKLFHNASAFRVHPDASTYKFLYKAYTKADMKEQVQILMKKM 444

Query: 242 LRASCCPD 265
+ P+
Sbjct: 445 EKDGIVPN 452



Score = 29.6 bits (65), Expect = 4.9
Identities = 16/68 (23%), Positives = 31/68 (45%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
+K + ++M N P +T+ + + G S+ ++FE++ ST N +
Sbjct: 330 DKAEWVFKKMNDMNYIPSFITYECMIMMYGYCGSVSRAREIFEEVGESDRVLKASTLNAM 389

Query: 182 IETYGRLG 205
+E Y R G
Sbjct: 390 LEVYCRNG 397


>sp|Q9M302|PP270_ARATH Pentatricopeptide repeat-containing protein
At3g48810 OS=Arabidopsis thaliana GN=At3g48810 PE=2 SV=1
Length = 659

Score = 55.5 bits (132), Expect = 8e-08
Identities = 24/73 (32%), Positives = 40/73 (54%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
P++V +NTL F HG + VF M +G P+ T+ LI + + GS + A+ +
Sbjct: 350 PNVVAYNTLVQGFCSHGNIVKAVSVFSHMEEIGCSPNIRTYGSLINGFAKRGSLDGAVYI 409

Query: 230 YKAMLRASCCPDI 268
+ ML + CCP++
Sbjct: 410 WNKMLTSGCCPNV 422



Score = 44.7 bits (104), Expect = 1e-04
Identities = 22/88 (25%), Positives = 41/88 (46%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ + M +K C P + +N + ++ + V+ DM+R G EP+ T+N+L
Sbjct: 128 ERAVEMFYRIKEFGCDPSVKIYNHVLDTLLGENRIQMIYMVYRDMKRDGFEPNVFTYNVL 187

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
++ + + A + M CCPD
Sbjct: 188 LKALCKNNKVDGAKKLLVEMSNKGCCPD 215



Score = 37.4 bits (85), Expect = 0.024
Identities = 19/88 (21%), Positives = 41/88 (46%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
K + + M+ C+P+I T+ +L N F++ G ++ M G P+ + ++
Sbjct: 370 KAVSVFSHMEEIGCSPNIRTYGSLINGFAKRGSLDGAVYIWNKMLTSGCCPNVVVYTNMV 429

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
E R ++A + + M + +C P +
Sbjct: 430 EALCRHSKFKEAESLIEIMSKENCAPSV 457



Score = 34.3 bits (77), Expect = 0.20
Identities = 18/79 (22%), Positives = 33/79 (41%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
+M C P++V + + + +H + + E M + P TFN I+ G
Sbjct: 412 KMLTSGCCPNVVVYTNMVEALCRHSKFKEAESLIEIMSKENCAPSVPTFNAFIKGLCDAG 471

Query: 206 SAEQALGVYKAMLRASCCP 262
+ A V++ M + CP
Sbjct: 472 RLDWAEKVFRQMEQQHRCP 490



Score = 33.9 bits (76), Expect = 0.26
Identities = 20/72 (27%), Positives = 32/72 (44%), Gaps = 1/72 (1%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDN-STFNILIETY 193
++E M NCAP + T+N G +VF M + P N T+N L++
Sbjct: 444 LIEIMSKENCAPSVPTFNAFIKGLCDAGRLDWAEKVFRQMEQQHRCPPNIVTYNELLDGL 503

Query: 194 GRLGSAEQALGV 229
+ E+A G+
Sbjct: 504 AKANRIEEAYGL 515



Score = 32.7 bits (73), Expect = 0.58
Identities = 19/53 (35%), Positives = 26/53 (49%)
Frame = +2

Query: 62 TWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQA 220
T+NTL + GL Q+ M G PD T N++I Y + G AE+A
Sbjct: 530 TYNTLLHGSCNAGLPGIALQLVGKMMVDGKSPDEITMNMIILAYCKQGKAERA 582


>sp|Q9LN22|PPR54_ARATH Pentatricopeptide repeat-containing protein
At1g20300, mitochondrial OS=Arabidopsis thaliana
GN=At1g20300 PE=2 SV=1
Length = 537

Score = 55.1 bits (131), Expect = 1e-07
Identities = 27/77 (35%), Positives = 43/77 (55%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
+M CAP+ +T+N L + G +V QV+ M+++G EPD T+N LIE + R
Sbjct: 315 DMLDSGCAPNAITFNNLMRVHVKAGRTEKVLQVYNQMKKLGCEPDTITYNFLIEAHCRDE 374

Query: 206 SAEQALGVYKAMLRASC 256
+ E A+ V M++ C
Sbjct: 375 NLENAVKVLNTMIKKKC 391



Score = 48.5 bits (114), Expect = 1e-05
Identities = 26/81 (32%), Positives = 42/81 (51%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+EMK P++ T++ + ++ + G S+ VF DM G P+ TFN L+ + +
Sbjct: 279 KEMKLAGIEPNVYTYSIVIDALCRCGQISRAHDVFADMLDSGCAPNAITFNNLMRVHVKA 338

Query: 203 GSAEQALGVYKAMLRASCCPD 265
G E+ L VY M + C PD
Sbjct: 339 GRTEKVLQVYNQMKKLGCEPD 359



Score = 47.0 bits (110), Expect = 3e-05
Identities = 22/72 (30%), Positives = 41/72 (56%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD++ + L + + G S+ +VF++M+ G EP+ T++I+I+ R G +A V
Sbjct: 253 PDVIVYTNLVRGWCRAGEISEAEKVFKEMKLAGIEPNVYTYSIVIDALCRCGQISRAHDV 312

Query: 230 YKAMLRASCCPD 265
+ ML + C P+
Sbjct: 313 FADMLDSGCAPN 324



Score = 40.0 bits (92), Expect = 0.004
Identities = 23/88 (26%), Positives = 39/88 (44%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK++ + +MK C PD +T+N L + + +V M + E + STFN +
Sbjct: 342 EKVLQVYNQMKKLGCEPDTITYNFLIEAHCRDENLENAVKVLNTMIKKKCEVNASTFNTI 401

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
+ A +Y M+ A C P+
Sbjct: 402 FRYIEKKRDVNGAHRMYSKMMEAKCEPN 429



Score = 36.6 bits (83), Expect = 0.040
Identities = 20/80 (25%), Positives = 37/80 (46%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M +M C P+ VT+N L F V ++ ++M EP+ +T+ +L+ +
Sbjct: 417 MYSKMMEAKCEPNTVTYNILMRMFVGSKSTDMVLKMKKEMDDKEVEPNVNTYRLLVTMFC 476

Query: 197 RLGSAEQALGVYKAMLRASC 256
+G A ++K M+ C
Sbjct: 477 GMGHWNNAYKLFKEMVEEKC 496



Score = 31.6 bits (70), Expect = 1.3
Identities = 19/80 (23%), Positives = 38/80 (47%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
M+ C PD + ++ + ++ S+ S+ F+ ++ EPD + L+ + R G
Sbjct: 212 MEDYGCVPDKIAFSIVISNLSRKRRASEAQSFFDSLKD-RFEPDVIVYTNLVRGWCRAGE 270

Query: 209 AEQALGVYKAMLRASCCPDI 268
+A V+K M A P++
Sbjct: 271 ISEAEKVFKEMKLAGIEPNV 290



Score = 28.9 bits (63), Expect = 8.4
Identities = 14/33 (42%), Positives = 17/33 (51%)
Frame = +2

Query: 167 TFNILIETYGRLGSAEQALGVYKAMLRASCCPD 265
TF ILI Y R G A +A+ + M C PD
Sbjct: 188 TFTILIRRYVRAGLASEAVHCFNRMEDYGCVPD 220


tr_hit_id A9TMK7
Definition tr|A9TMK7|A9TMK7_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 88
Score (bit) 110.0
E-value 5.0e-23
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919264|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_B01.
(268 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TMK7|A9TMK7_PHYPA Predicted protein OS=Physcomitrella paten... 110 5e-23
tr|A7QW79|A7QW79_VITVI Chromosome chr3 scaffold_199, whole genom... 96 7e-19
tr|A2YN84|A2YN84_ORYSI Putative uncharacterized protein OS=Oryza... 80 4e-14
tr|Q6ZLH4|Q6ZLH4_ORYSJ Os07g0590600 protein OS=Oryza sativa subs... 80 7e-14
tr|A3BLQ8|A3BLQ8_ORYSJ Putative uncharacterized protein OS=Oryza... 80 7e-14
tr|A7Q6B7|A7Q6B7_VITVI Chromosome chr11 scaffold_56, whole genom... 75 2e-12
tr|A5CB03|A5CB03_VITVI Putative uncharacterized protein OS=Vitis... 75 2e-12
tr|Q6H7X0|Q6H7X0_ORYSJ Os02g0170000 protein OS=Oryza sativa subs... 72 1e-11
tr|B8AII6|B8AII6_ORYSI Putative uncharacterized protein OS=Oryza... 72 1e-11
tr|A3A3K8|A3A3K8_ORYSJ Putative uncharacterized protein OS=Oryza... 72 1e-11
tr|Q6H5Z3|Q6H5Z3_ORYSJ Os02g0226900 protein OS=Oryza sativa subs... 71 3e-11
tr|B8AEI7|B8AEI7_ORYSI Putative uncharacterized protein OS=Oryza... 71 3e-11
tr|B6U1C3|B6U1C3_MAIZE Putative uncharacterized protein OS=Zea m... 71 3e-11
tr|A3A4R3|A3A4R3_ORYSJ Putative uncharacterized protein OS=Oryza... 71 3e-11
tr|A9SSM7|A9SSM7_PHYPA Predicted protein OS=Physcomitrella paten... 69 9e-11
tr|A2Q1M9|A2Q1M9_MEDTR Tetratricopeptide-like helical OS=Medicag... 68 2e-10
tr|A9RIA0|A9RIA0_PHYPA Predicted protein OS=Physcomitrella paten... 67 4e-10
tr|B8Y6I0|B8Y6I0_MAIZE Chloroplast pentatricopeptide repeat prot... 65 1e-09
tr|Q6ATD8|Q6ATD8_ORYSJ Os05g0275000 protein OS=Oryza sativa subs... 64 3e-09
tr|A3B237|A3B237_ORYSJ Putative uncharacterized protein OS=Oryza... 64 3e-09
tr|A2Y2N2|A2Y2N2_ORYSI Putative uncharacterized protein OS=Oryza... 64 3e-09
tr|A7PJV6|A7PJV6_VITVI Chromosome chr12 scaffold_18, whole genom... 63 8e-09
tr|Q2QXL4|Q2QXL4_ORYSJ Os12g0152600 protein OS=Oryza sativa subs... 62 2e-08
tr|A9S042|A9S042_PHYPA Predicted protein OS=Physcomitrella paten... 62 2e-08
tr|A2ZI56|A2ZI56_ORYSI Putative uncharacterized protein OS=Oryza... 62 2e-08
tr|Q69K58|Q69K58_ORYSJ Os06g0199100 protein OS=Oryza sativa subs... 61 2e-08
tr|B8B3Q4|B8B3Q4_ORYSI Putative uncharacterized protein OS=Oryza... 61 2e-08
tr|A7P711|A7P711_VITVI Chromosome chr9 scaffold_7, whole genome ... 61 2e-08
tr|A5CBK8|A5CBK8_VITVI Putative uncharacterized protein OS=Vitis... 61 2e-08
tr|A3B9B4|A3B9B4_ORYSJ Putative uncharacterized protein OS=Oryza... 61 2e-08

>tr|A9TMK7|A9TMK7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_110446 PE=4 SV=1
Length = 730

Score = 110 bits (274), Expect = 5e-23
Identities = 47/88 (53%), Positives = 68/88 (77%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+MM++ E+M+AC PDIVTWN+L +F ++G++S+V +VF M++ G EPD +TFNILI
Sbjct: 346 EMMVIFEDMQACGVEPDIVTWNSLLGAFGKNGMYSEVLKVFRGMKKAGFEPDKATFNILI 405

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
E YGR GS++QAL +Y ML+A C PD+
Sbjct: 406 EAYGRCGSSDQALSIYDGMLQAGCTPDL 433



Score = 63.9 bits (154), Expect = 4e-09
Identities = 29/83 (34%), Positives = 50/83 (60%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM++ C P+IVT+N L ++F + GL + ++ + M G EPD T+ L+ Y
Sbjct: 245 VLKEMESAGCLPNIVTYNELLSAFGRAGLCNAAAEMKDSMVSKGIEPDVFTYTSLLSAYS 304

Query: 197 RLGSAEQALGVYKAMLRASCCPD 265
R G EQA+ +Y M ++C P+
Sbjct: 305 RAGKVEQAMEIYNQMRTSNCTPN 327



Score = 60.5 bits (145), Expect = 4e-08
Identities = 31/89 (34%), Positives = 47/89 (52%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E ++ + EEMKA PD T+NT + + L + T++F M+ PD T+N L
Sbjct: 170 ENILELFEEMKAQGIQPDEYTYNTAITACASGSLCEEATELFTQMKSSNCTPDRVTYNAL 229

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
++ YG+ G +A V K M A C P+I
Sbjct: 230 LDVYGKAGWYNEAANVLKEMESAGCLPNI 258



Score = 59.7 bits (143), Expect = 7e-08
Identities = 30/82 (36%), Positives = 46/82 (56%)
Frame = +2

Query: 20 VEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGR 199
+ E A PD+V++NT+ S+S+HG S T++F +M G +PD+ T+N + Y
Sbjct: 596 LRECMAAGQTPDLVSYNTVIFSYSKHGQLSSATRIFHEMVSNGIQPDSFTYNTFVGCYVN 655

Query: 200 LGSAEQALGVYKAMLRASCCPD 265
G +AL V K M + C PD
Sbjct: 656 GGMFPEALSVVKHMHKTGCKPD 677



Score = 53.5 bits (127), Expect = 5e-06
Identities = 26/89 (29%), Positives = 47/89 (52%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ + +MK+ NC PD VT+N L + + + G +++ V ++M G P+ T+N L
Sbjct: 205 EEATELFTQMKSSNCTPDRVTYNALLDVYGKAGWYNEAANVLKEMESAGCLPNIVTYNEL 264

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ +GR G A + +M+ PD+
Sbjct: 265 LSAFGRAGLCNAAAEMKDSMVSKGIEPDV 293



Score = 46.2 bits (108), Expect = 8e-04
Identities = 23/82 (28%), Positives = 42/82 (51%), Gaps = 1/82 (1%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLH-SQVTQVFEDMRRVGHEPDNSTFNILIETYGR 199
E+MK P +VT+N + + + + G + ++FE+M+ G +PD T+N I
Sbjct: 141 EQMKEAGPQPSLVTYNVIIDLYGKKGRSWENILELFEEMKAQGIQPDEYTYNTAITACAS 200

Query: 200 LGSAEQALGVYKAMLRASCCPD 265
E+A ++ M ++C PD
Sbjct: 201 GSLCEEATELFTQMKSSNCTPD 222



Score = 43.9 bits (102), Expect = 0.004
Identities = 22/84 (26%), Positives = 44/84 (52%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M + M + PD+ T+ +L +++S+ G Q +++ MR P++ TFN LI +G
Sbjct: 280 MKDSMVSKGIEPDVFTYTSLLSAYSRAGKVEQAMEIYNQMRTSNCTPNSFTFNALIGMHG 339

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ + + + +++ M PDI
Sbjct: 340 KNKNFSEMMVIFEDMQACGVEPDI 363



Score = 42.0 bits (97), Expect = 0.015
Identities = 21/72 (29%), Positives = 35/72 (48%)
Frame = +2

Query: 53 DIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVY 232
D T+N + + + + G+ + T F +R G EPD T+N L+ YGR G +
Sbjct: 537 DTSTFNAMISMYGKKGMMDKATDTFALLRSTGLEPDVVTYNCLMGMYGREGMYRKCEATL 596

Query: 233 KAMLRASCCPDI 268
+ + A PD+
Sbjct: 597 RECMAAGQTPDL 608



Score = 41.2 bits (95), Expect = 0.026
Identities = 19/70 (27%), Positives = 34/70 (48%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EM + PD T+NT + G+ + V + M + G +PD T+ L++ Y ++G
Sbjct: 633 EMVSNGIQPDSFTYNTFVGCYVNGGMFPEALSVVKHMHKTGCKPDEVTYRTLVDAYCKIG 692

Query: 206 SAEQALGVYK 235
E+ + K
Sbjct: 693 KFEEVERILK 702



Score = 39.3 bits (90), Expect = 0.098
Identities = 20/72 (27%), Positives = 38/72 (52%), Gaps = 1/72 (1%)
Frame = +2

Query: 53 DIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG-SAEQALGV 229
D+ + +L ++ S++ + FE M+ G +P T+N++I+ YG+ G S E L +
Sbjct: 116 DVYAYTSLISALSRNRKFKEALGFFEQMKEAGPQPSLVTYNVIIDLYGKKGRSWENILEL 175

Query: 230 YKAMLRASCCPD 265
++ M PD
Sbjct: 176 FEEMKAQGIQPD 187



Score = 37.4 bits (85), Expect = 0.37
Identities = 23/89 (25%), Positives = 38/89 (42%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK+ MV+ + + T +S+ L + F MR G+ D STFN +
Sbjct: 485 EKLKEMVDTLHTIYVPFTKILLKTFVLVYSKCSLVDEAEDAFLAMRHHGYLSDTSTFNAM 544

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I YG+ G ++A + + PD+
Sbjct: 545 ISMYGKKGMMDKATDTFALLRSTGLEPDV 573



Score = 37.0 bits (84), Expect = 0.49
Identities = 14/72 (19%), Positives = 36/72 (50%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++ + + + M C PD+ T+NTL + ++ G + +++ R ++P++ + +
Sbjct: 415 DQALSIYDGMLQAGCTPDLATFNTLLAALAREGRWEHAELILDELNRSSYKPNDIAYASM 474

Query: 182 IETYGRLGSAEQ 217
+ Y G E+
Sbjct: 475 LHAYANGGELEK 486


>tr|A7QW79|A7QW79_VITVI Chromosome chr3 scaffold_199, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00007731001
PE=4 SV=1
Length = 811

Score = 96.3 bits (238), Expect = 7e-19
Identities = 44/88 (50%), Positives = 62/88 (70%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+MM + E++K C+PDIVTWNTL + F Q+G+ S+V+ VF++M+R G P+ TFN LI
Sbjct: 429 EMMKVFEDIKTFQCSPDIVTWNTLLSVFGQNGMDSEVSGVFKEMKRAGFVPERDTFNTLI 488

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+Y R GS +QA+ VYK ML A PD+
Sbjct: 489 SSYSRCGSFDQAMAVYKRMLEAGVNPDL 516



Score = 60.1 bits (144), Expect = 5e-08
Identities = 29/88 (32%), Positives = 50/88 (56%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
KM+ +V+ MK+ APD T+NTL + + L+ + V ++M+ G PD T+N L+
Sbjct: 254 KMVGLVDRMKSAGIAPDSYTYNTLISCCRRGNLYEEAAGVLKEMKLAGFSPDKVTYNALL 313

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ YG+ +++A+ V + M C P I
Sbjct: 314 DVYGKSRRSKEAMEVLQEMEGNGCPPSI 341



Score = 56.2 bits (134), Expect = 8e-07
Identities = 28/89 (31%), Positives = 46/89 (51%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E + + +M PD+ T+ TL + F + G Q+FE+MR G +P+ TFN L
Sbjct: 358 EDALELKNQMVEKGIKPDVFTYTTLLSGFEKAGKDKAAVQIFEEMRNEGCKPNICTFNAL 417

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I+ +G G + + V++ + C PDI
Sbjct: 418 IKMHGNRGKFTEMMKVFEDIKTFQCSPDI 446



Score = 51.6 bits (122), Expect = 2e-05
Identities = 24/89 (26%), Positives = 50/89 (56%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++ M +++EM+ C P IVT+N+L +++++ GL ++ M G +PD T+ L
Sbjct: 323 KEAMEVLQEMEGNGCPPSIVTYNSLISAYARDGLLEDALELKNQMVEKGIKPDVFTYTTL 382

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ + + G + A+ +++ M C P+I
Sbjct: 383 LSGFEKAGKDKAAVQIFEEMRNEGCKPNI 411



Score = 47.8 bits (112), Expect = 3e-04
Identities = 26/84 (30%), Positives = 42/84 (50%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EMK +PD VT+N L + + + + +V ++M G P T+N LI Y
Sbjct: 293 VLKEMKLAGFSPDKVTYNALLDVYGKSRRSKEAMEVLQEMEGNGCPPSIVTYNSLISAYA 352

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G E AL + M+ PD+
Sbjct: 353 RDGLLEDALELKNQMVEKGIKPDV 376



Score = 47.4 bits (111), Expect = 4e-04
Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 1/86 (1%)
Frame = +2

Query: 11 MLMVEEMKACNCAPDIVTWNTL*NSFSQHGLH-SQVTQVFEDMRRVGHEPDNSTFNILIE 187
+++ ++M+ C P ++T+N + N + + G+ +++ + + M+ G PD+ T+N LI
Sbjct: 220 VMVFKKMEEVGCKPTLITYNVILNVYGKMGMPWNKMVGLVDRMKSAGIAPDSYTYNTLIS 279

Query: 188 TYGRLGSAEQALGVYKAMLRASCCPD 265
R E+A GV K M A PD
Sbjct: 280 CCRRGNLYEEAAGVLKEMKLAGFSPD 305



Score = 46.2 bits (108), Expect = 8e-04
Identities = 24/88 (27%), Positives = 46/88 (52%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ ++ E+ A PDI+++NT+ ++ ++G ++V +MR G PD T+N
Sbjct: 673 ERSEEILREILAKGIRPDIISYNTVIYAYCRNGRMRDASRVLSEMRESGPAPDIITYNTF 732

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
I +Y +A+ V M++ C P+
Sbjct: 733 IASYAADSMFVEAIDVVCYMIKHGCKPN 760



Score = 44.7 bits (104), Expect = 0.002
Identities = 26/81 (32%), Positives = 41/81 (50%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+EMK P+ T+NTL +S+S+ G Q V++ M G PD S++N ++ R
Sbjct: 470 KEMKRAGFVPERDTFNTLISSYSRCGSFDQAMAVYKRMLEAGVNPDLSSYNAVLAALARG 529

Query: 203 GSAEQALGVYKAMLRASCCPD 265
G +Q+ V M C P+
Sbjct: 530 GLWKQSEKVLAEMKDGRCKPN 550



Score = 43.9 bits (102), Expect = 0.004
Identities = 19/72 (26%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
Frame = +2

Query: 53 DIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSA-EQALGV 229
D+ + ++ +F+ +G + + VF+ M VG +P T+N+++ YG++G + +G+
Sbjct: 199 DVYAYTSMITAFTSNGRYREAVMVFKKMEEVGCKPTLITYNVILNVYGKMGMPWNKMVGL 258

Query: 230 YKAMLRASCCPD 265
M A PD
Sbjct: 259 VDRMKSAGIAPD 270



Score = 42.0 bits (97), Expect = 0.015
Identities = 20/68 (29%), Positives = 39/68 (57%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ EM+ APDI+T+NT S++ + + V M + G +P+ ST+N +++ Y
Sbjct: 713 VLSEMRESGPAPDIITYNTFIASYAADSMFVEAIDVVCYMIKHGCKPNQSTYNSIVDWYC 772

Query: 197 RLGSAEQA 220
+L ++A
Sbjct: 773 KLNRRDEA 780



Score = 41.6 bits (96), Expect = 0.020
Identities = 20/81 (24%), Positives = 43/81 (53%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
E++ +PDI T N + + + + + ++ ++ + M+R G P +T+N L+ Y R
Sbjct: 611 ELRQRGFSPDITTLNAMVSIYGRRQMVAKANEILDCMKRGGFTPSLTTYNSLMYMYSRSA 670

Query: 206 SAEQALGVYKAMLRASCCPDI 268
+ E++ + + +L PDI
Sbjct: 671 NFERSEEILREILAKGIRPDI 691



Score = 37.7 bits (86), Expect = 0.29
Identities = 24/89 (26%), Positives = 40/89 (44%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+M + EE+ + P V TL S+ L + + F ++R+ G PD +T N +
Sbjct: 568 ERMCALAEEIYSGIIEPRAVLLKTLVLVNSKCDLLMETERAFLELRQRGFSPDITTLNAM 627

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ YGR +A + M R P +
Sbjct: 628 VSIYGRRQMVAKANEILDCMKRGGFTPSL 656



Score = 35.8 bits (81), Expect = 1.1
Identities = 21/80 (26%), Positives = 35/80 (43%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
MK P + T+N+L +S+ + ++ ++ G PD ++N +I Y R G
Sbjct: 647 MKRGGFTPSLTTYNSLMYMYSRSANFERSEEILREILAKGIRPDIISYNTVIYAYCRNGR 706

Query: 209 AEQALGVYKAMLRASCCPDI 268
A V M + PDI
Sbjct: 707 MRDASRVLSEMRESGPAPDI 726


>tr|A2YN84|A2YN84_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26694 PE=4 SV=1
Length = 784

Score = 80.5 bits (197), Expect = 4e-14
Identities = 36/88 (40%), Positives = 58/88 (65%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+MM + +E+++ PDIVTWNTL F Q+GL S+V+ VF++M++ G+ P+ T+ LI
Sbjct: 401 EMMAVFDELRSAGFVPDIVTWNTLLAVFGQNGLDSEVSGVFKEMKKAGYIPERDTYVSLI 460

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+Y R G + A+ +YK M+ A PD+
Sbjct: 461 SSYSRCGLFDLAMQIYKRMMEAGIYPDV 488



Score = 65.5 bits (158), Expect = 1e-09
Identities = 31/89 (34%), Positives = 52/89 (58%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++++ +V MK APD T+NTL + + L+ + QVF++M+ G EPD TFN L
Sbjct: 225 KEVVELVASMKEHGVAPDRYTYNTLISCCRRRALYKEAAQVFDEMKASGFEPDKVTFNSL 284

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
++ YG+ ++A+ V + M R C P +
Sbjct: 285 LDVYGKARRHDEAIEVIQEMERVGCPPSV 313



Score = 56.2 bits (134), Expect = 8e-07
Identities = 27/84 (32%), Positives = 47/84 (55%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM+ C P +VT+N+L +S+ + GL Q + ++M G +PD T+ LI
Sbjct: 300 VIQEMERVGCPPSVVTYNSLISSYVKDGLLEQAVALKQEMEVKGIKPDVVTYTTLISGLD 359

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G + A+ Y M+R C P++
Sbjct: 360 RAGKIDAAIVEYDEMVRNGCKPNL 383



Score = 53.9 bits (128), Expect = 4e-06
Identities = 29/82 (35%), Positives = 46/82 (56%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+EMKA PD VT+N+L + + + H + +V ++M RVG P T+N LI +Y +
Sbjct: 267 DEMKASGFEPDKVTFNSLLDVYGKARRHDEAIEVIQEMERVGCPPSVVTYNSLISSYVKD 326

Query: 203 GSAEQALGVYKAMLRASCCPDI 268
G EQA+ + + M PD+
Sbjct: 327 GLLEQAVALKQEMEVKGIKPDV 348



Score = 48.5 bits (114), Expect = 2e-04
Identities = 23/88 (26%), Positives = 50/88 (56%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK ++ E+K+ PD ++NT+ ++ + G + +++F +M+ G +PD T+NI
Sbjct: 645 EKCENILTEIKSSGVRPDRYSYNTVIYAYGRKGQMKEASRLFSEMKCSGLKPDVVTYNIF 704

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
+++Y E+A+ + + M+ C P+
Sbjct: 705 VKSYVSNSMFEEAIELVRYMVTQGCKPN 732



Score = 47.4 bits (111), Expect = 4e-04
Identities = 25/89 (28%), Positives = 46/89 (51%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ + + +EM+ PD+VT+ TL + + G +++M R G +P+ T+N L
Sbjct: 330 EQAVALKQEMEVKGIKPDVVTYTTLISGLDRAGKIDAAIVEYDEMVRNGCKPNLCTYNAL 389

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I+ +G G + + V+ + A PDI
Sbjct: 390 IKMHGVRGKFPEMMAVFDELRSAGFVPDI 418



Score = 40.0 bits (92), Expect = 0.057
Identities = 19/68 (27%), Positives = 33/68 (48%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+ EMK PD+VT+N S+ + + + ++ M G +P+ T+N ++E Y
Sbjct: 685 LFSEMKCSGLKPDVVTYNIFVKSYVSNSMFEEAIELVRYMVTQGCKPNERTYNSIVEGYC 744

Query: 197 RLGSAEQA 220
R G A
Sbjct: 745 RNGKLTDA 752



Score = 39.3 bits (90), Expect = 0.098
Identities = 23/89 (25%), Positives = 48/89 (53%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK++ +++E A N + T+N+L + +S+ G + + +++ G PD ++N +
Sbjct: 613 EKILSLMKE-SAINLSA--ATYNSLMHMYSRLGDCEKCENILTEIKSSGVRPDRYSYNTV 669

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I YGR G ++A ++ M + PD+
Sbjct: 670 IYAYGRKGQMKEASRLFSEMKCSGLKPDV 698


>tr|Q6ZLH4|Q6ZLH4_ORYSJ Os07g0590600 protein OS=Oryza sativa subsp.
japonica GN=OJ1174_G05.19 PE=4 SV=1
Length = 784

Score = 79.7 bits (195), Expect = 7e-14
Identities = 36/88 (40%), Positives = 57/88 (64%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+MM + +E ++ PDIVTWNTL F Q+GL S+V+ VF++M++ G+ P+ T+ LI
Sbjct: 401 EMMAVFDEFRSAGFVPDIVTWNTLLAVFGQNGLDSEVSGVFKEMKKAGYIPERDTYVSLI 460

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+Y R G + A+ +YK M+ A PD+
Sbjct: 461 SSYSRCGLFDLAMQIYKRMMEAGIYPDV 488



Score = 65.5 bits (158), Expect = 1e-09
Identities = 31/89 (34%), Positives = 52/89 (58%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++++ +V MK APD T+NTL + + L+ + QVF++M+ G EPD TFN L
Sbjct: 225 KEVVELVASMKEHGVAPDRYTYNTLISCCRRRALYKEAAQVFDEMKASGFEPDKVTFNSL 284

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
++ YG+ ++A+ V + M R C P +
Sbjct: 285 LDVYGKARRHDEAIEVIQEMERVGCPPSV 313



Score = 56.6 bits (135), Expect = 6e-07
Identities = 27/84 (32%), Positives = 47/84 (55%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM+ C P +VT+N+L +S+ + GL Q + ++M G +PD T+ LI
Sbjct: 300 VIQEMERVGCPPSVVTYNSLISSYVKDGLLEQAVALKQEMEVKGMKPDVVTYTTLISGLD 359

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G + A+ Y M+R C P++
Sbjct: 360 RAGKIDAAIVEYDEMVRNGCKPNL 383



Score = 53.9 bits (128), Expect = 4e-06
Identities = 29/82 (35%), Positives = 46/82 (56%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+EMKA PD VT+N+L + + + H + +V ++M RVG P T+N LI +Y +
Sbjct: 267 DEMKASGFEPDKVTFNSLLDVYGKARRHDEAIEVIQEMERVGCPPSVVTYNSLISSYVKD 326

Query: 203 GSAEQALGVYKAMLRASCCPDI 268
G EQA+ + + M PD+
Sbjct: 327 GLLEQAVALKQEMEVKGMKPDV 348



Score = 48.5 bits (114), Expect = 2e-04
Identities = 23/88 (26%), Positives = 50/88 (56%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK ++ E+K+ PD ++NT+ ++ + G + +++F +M+ G +PD T+NI
Sbjct: 645 EKCENILTEIKSSGVRPDRYSYNTVIYAYGRKGQMKEASRLFSEMKCSGLKPDVVTYNIF 704

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
+++Y E+A+ + + M+ C P+
Sbjct: 705 VKSYVSNSMFEEAIELVRYMVTQGCKPN 732



Score = 46.6 bits (109), Expect = 6e-04
Identities = 25/89 (28%), Positives = 45/89 (50%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ + + +EM+ PD+VT+ TL + + G +++M R G +P+ T+N L
Sbjct: 330 EQAVALKQEMEVKGMKPDVVTYTTLISGLDRAGKIDAAIVEYDEMVRNGCKPNLCTYNAL 389

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I+ +G G + + V+ A PDI
Sbjct: 390 IKMHGVRGKFPEMMAVFDEFRSAGFVPDI 418



Score = 40.0 bits (92), Expect = 0.057
Identities = 19/68 (27%), Positives = 33/68 (48%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+ EMK PD+VT+N S+ + + + ++ M G +P+ T+N ++E Y
Sbjct: 685 LFSEMKCSGLKPDVVTYNIFVKSYVSNSMFEEAIELVRYMVTQGCKPNERTYNSIVEGYC 744

Query: 197 RLGSAEQA 220
R G A
Sbjct: 745 RNGKLTDA 752



Score = 39.3 bits (90), Expect = 0.098
Identities = 23/89 (25%), Positives = 48/89 (53%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK++ +++E A N + T+N+L + +S+ G + + +++ G PD ++N +
Sbjct: 613 EKILSLMKE-SAINLSA--ATYNSLMHMYSRLGDCEKCENILTEIKSSGVRPDRYSYNTV 669

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I YGR G ++A ++ M + PD+
Sbjct: 670 IYAYGRKGQMKEASRLFSEMKCSGLKPDV 698


>tr|A3BLQ8|A3BLQ8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_023980 PE=4 SV=1
Length = 766

Score = 79.7 bits (195), Expect = 7e-14
Identities = 36/88 (40%), Positives = 57/88 (64%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
+MM + +E ++ PDIVTWNTL F Q+GL S+V+ VF++M++ G+ P+ T+ LI
Sbjct: 383 EMMAVFDEFRSAGFVPDIVTWNTLLAVFGQNGLDSEVSGVFKEMKKAGYIPERDTYVSLI 442

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+Y R G + A+ +YK M+ A PD+
Sbjct: 443 SSYSRCGLFDLAMQIYKRMMEAGIYPDV 470



Score = 65.5 bits (158), Expect = 1e-09
Identities = 31/89 (34%), Positives = 52/89 (58%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
++++ +V MK APD T+NTL + + L+ + QVF++M+ G EPD TFN L
Sbjct: 207 KEVVELVASMKEHGVAPDRYTYNTLISCCRRRALYKEAAQVFDEMKASGFEPDKVTFNSL 266

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
++ YG+ ++A+ V + M R C P +
Sbjct: 267 LDVYGKARRHDEAIEVIQEMERVGCPPSV 295



Score = 56.6 bits (135), Expect = 6e-07
Identities = 27/84 (32%), Positives = 47/84 (55%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM+ C P +VT+N+L +S+ + GL Q + ++M G +PD T+ LI
Sbjct: 282 VIQEMERVGCPPSVVTYNSLISSYVKDGLLEQAVALKQEMEVKGMKPDVVTYTTLISGLD 341

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G + A+ Y M+R C P++
Sbjct: 342 RAGKIDAAIVEYDEMVRNGCKPNL 365



Score = 53.9 bits (128), Expect = 4e-06
Identities = 29/82 (35%), Positives = 46/82 (56%)
Frame = +2

Query: 23 EEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRL 202
+EMKA PD VT+N+L + + + H + +V ++M RVG P T+N LI +Y +
Sbjct: 249 DEMKASGFEPDKVTFNSLLDVYGKARRHDEAIEVIQEMERVGCPPSVVTYNSLISSYVKD 308

Query: 203 GSAEQALGVYKAMLRASCCPDI 268
G EQA+ + + M PD+
Sbjct: 309 GLLEQAVALKQEMEVKGMKPDV 330



Score = 48.5 bits (114), Expect = 2e-04
Identities = 23/88 (26%), Positives = 50/88 (56%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK ++ E+K+ PD ++NT+ ++ + G + +++F +M+ G +PD T+NI
Sbjct: 627 EKCENILTEIKSSGVRPDRYSYNTVIYAYGRKGQMKEASRLFSEMKCSGLKPDVVTYNIF 686

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPD 265
+++Y E+A+ + + M+ C P+
Sbjct: 687 VKSYVSNSMFEEAIELVRYMVTQGCKPN 714



Score = 46.6 bits (109), Expect = 6e-04
Identities = 25/89 (28%), Positives = 45/89 (50%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+ + + +EM+ PD+VT+ TL + + G +++M R G +P+ T+N L
Sbjct: 312 EQAVALKQEMEVKGMKPDVVTYTTLISGLDRAGKIDAAIVEYDEMVRNGCKPNLCTYNAL 371

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I+ +G G + + V+ A PDI
Sbjct: 372 IKMHGVRGKFPEMMAVFDEFRSAGFVPDI 400



Score = 40.0 bits (92), Expect = 0.057
Identities = 19/68 (27%), Positives = 33/68 (48%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+ EMK PD+VT+N S+ + + + ++ M G +P+ T+N ++E Y
Sbjct: 667 LFSEMKCSGLKPDVVTYNIFVKSYVSNSMFEEAIELVRYMVTQGCKPNERTYNSIVEGYC 726

Query: 197 RLGSAEQA 220
R G A
Sbjct: 727 RNGKLTDA 734



Score = 39.3 bits (90), Expect = 0.098
Identities = 23/89 (25%), Positives = 48/89 (53%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK++ +++E A N + T+N+L + +S+ G + + +++ G PD ++N +
Sbjct: 595 EKILSLMKE-SAINLSA--ATYNSLMHMYSRLGDCEKCENILTEIKSSGVRPDRYSYNTV 651

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCPDI 268
I YGR G ++A ++ M + PD+
Sbjct: 652 IYAYGRKGQMKEASRLFSEMKCSGLKPDV 680


>tr|A7Q6B7|A7Q6B7_VITVI Chromosome chr11 scaffold_56, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00031331001
PE=4 SV=1
Length = 821

Score = 75.1 bits (183), Expect = 2e-12
Identities = 35/87 (40%), Positives = 53/87 (60%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+M+ M+ +M++ CAP+ VTWNT+ G+H V +VF +M+ G EP+ TFN L
Sbjct: 437 EEMIDMLCDMRSNGCAPNSVTWNTMLAMCGNKGMHKYVNRVFREMKSCGFEPNRDTFNAL 496

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCP 262
I YGR GS + +Y+ M++A P
Sbjct: 497 IGAYGRCGSQIDVVKMYEEMIKAGFTP 523



Score = 60.5 bits (145), Expect = 4e-08
Identities = 26/84 (30%), Positives = 48/84 (57%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM+ NC PD+VT+N L ++ + G H + + M R G P+ T+ +I YG
Sbjct: 337 ILKEMEKNNCPPDLVTYNELVAAYVRAGFHEEGADFIDTMIRKGIMPNAITYTTVINAYG 396

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ G ++AL ++ M + C P++
Sbjct: 397 KAGKEDKALSFFRQMKESGCVPNV 420



Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++E+ + D+ W T+ +++S+ G + + +FE MR+ G P T+N++++ YG
Sbjct: 196 LLDEISVEEYSLDVRAWTTILHAYSRIGKYERAITMFEKMRKTGLSPTLVTYNVMLDVYG 255

Query: 197 RLG-SAEQALGVYKAM 241
++G S + LG+ M
Sbjct: 256 KMGRSWNKILGLLDEM 271



Score = 46.2 bits (108), Expect = 8e-04
Identities = 22/88 (25%), Positives = 49/88 (55%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
K++ +++EM++ D T +T+ ++ + GL + + F ++ G+ T+N L+
Sbjct: 263 KILGLLDEMRSNGLEFDEFTCSTVISACGREGLLDEARKFFARLKSEGYVAGTFTYNSLL 322

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ +G+ G +AL + K M + +C PD+
Sbjct: 323 QVFGKAGIYSEALSILKEMEKNNCPPDL 350



Score = 42.7 bits (99), Expect = 0.009
Identities = 22/68 (32%), Positives = 36/68 (52%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EMK+C P+ T+N L ++ + G V +++E+M + G P +T+N L+ R G
Sbjct: 480 EMKSCGFEPNRDTFNALIGAYGRCGSQIDVVKMYEEMIKAGFTPCVTTYNALLNALARRG 539

Query: 206 SAEQALGV 229
E A V
Sbjct: 540 DWEAAESV 547



Score = 40.0 bits (92), Expect = 0.057
Identities = 19/68 (27%), Positives = 34/68 (50%)
Frame = +2

Query: 62 TWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVYKAM 241
T+N+L F + G++S+ + ++M + PD T+N L+ Y R G E+ M
Sbjct: 317 TYNSLLQVFGKAGIYSEALSILKEMEKNNCPPDLVTYNELVAAYVRAGFHEEGADFIDTM 376

Query: 242 LRASCCPD 265
+R P+
Sbjct: 377 IRKGIMPN 384



Score = 40.0 bits (92), Expect = 0.057
Identities = 18/73 (24%), Positives = 42/73 (57%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD+V +N++ + F+++ ++ + ++ +R G +PD T+N L++ Y R G + +
Sbjct: 628 PDLVLFNSMLSIFAKNKMYDRAHEMLRLIRESGLQPDLVTYNSLMDMYARGGECWKGEEI 687

Query: 230 YKAMLRASCCPDI 268
K + ++ PD+
Sbjct: 688 LKGIQKSGGKPDL 700



Score = 38.5 bits (88), Expect = 0.17
Identities = 17/64 (26%), Positives = 34/64 (53%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M EEM P + T+N L N+ ++ G V DM+ G +P+ +++++++ Y
Sbjct: 512 MYEEMIKAGFTPCVTTYNALLNALARRGDWEAAESVILDMKSKGFKPNETSYSLMLNCYA 571

Query: 197 RLGS 208
+ G+
Sbjct: 572 KGGN 575



Score = 37.7 bits (86), Expect = 0.29
Identities = 19/72 (26%), Positives = 33/72 (45%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD+V++NT+ F + GL + + +M G P T+N + Y G + V
Sbjct: 698 PDLVSYNTVIKGFCRQGLMQEAIRTLSEMTISGIRPCIVTYNTFVAGYSGKGMFSEVEEV 757

Query: 230 YKAMLRASCCPD 265
M++ C P+
Sbjct: 758 ISYMIQHDCRPN 769



Score = 36.6 bits (83), Expect = 0.64
Identities = 16/72 (22%), Positives = 34/72 (47%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
P+ +T+ T+ N++ + G + F M+ G P+ T+N ++ G+ E+ + +
Sbjct: 383 PNAITYTTVINAYGKAGKEDKALSFFRQMKESGCVPNVCTYNAILGMLGKKSRLEEMIDM 442

Query: 230 YKAMLRASCCPD 265
M C P+
Sbjct: 443 LCDMRSNGCAPN 454



Score = 36.6 bits (83), Expect = 0.64
Identities = 19/84 (22%), Positives = 46/84 (54%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M+ ++ PD+VT+N+L + +++ G + ++ + +++ G +PD ++N +I+ +
Sbjct: 652 MLRLIRESGLQPDLVTYNSLMDMYARGGECWKGEEILKGIQKSGGKPDLVSYNTVIKGFC 711

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G ++A+ M + P I
Sbjct: 712 RQGLMQEAIRTLSEMTISGIRPCI 735



Score = 34.7 bits (78), Expect = 2.4
Identities = 18/58 (31%), Positives = 30/58 (51%)
Frame = +2

Query: 20 VEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETY 193
+ EM P IVT+NT +S G+ S+V +V M + P+ T+ I+++ Y
Sbjct: 723 LSEMTISGIRPCIVTYNTFVAGYSGKGMFSEVEEVISYMIQHDCRPNELTYKIVVDGY 780


>tr|A5CB03|A5CB03_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_030525 PE=4 SV=1
Length = 821

Score = 75.1 bits (183), Expect = 2e-12
Identities = 35/87 (40%), Positives = 53/87 (60%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
E+M+ M+ +M++ CAP+ VTWNT+ G+H V +VF +M+ G EP+ TFN L
Sbjct: 437 EEMIDMLCDMRSNGCAPNSVTWNTMLAMCGNKGMHKYVNRVFREMKSCGFEPNRDTFNAL 496

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCP 262
I YGR GS + +Y+ M++A P
Sbjct: 497 IGAYGRCGSQIDVVKMYEEMIKAGFTP 523



Score = 60.5 bits (145), Expect = 4e-08
Identities = 26/84 (30%), Positives = 48/84 (57%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++EM+ NC PD+VT+N L ++ + G H + + M R G P+ T+ +I YG
Sbjct: 337 ILKEMEKNNCPPDLVTYNELVAAYVRAGFHEEGADFIDTMIRKGIMPNAITYTTVINAYG 396

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ G ++AL ++ M + C P++
Sbjct: 397 KAGKEDKALSFFRQMKESGCVPNV 420



Score = 47.0 bits (110), Expect = 5e-04
Identities = 21/76 (27%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
+++E+ + D+ W T+ +++S+ G + + +FE MR+ G P T+N++++ YG
Sbjct: 196 LLDEISVEEYSLDVRAWTTILHAYSRIGKYERAITMFEKMRKTGLSPTLVTYNVMLDVYG 255

Query: 197 RLG-SAEQALGVYKAM 241
++G S + LG+ M
Sbjct: 256 KMGRSWNKILGLLDEM 271



Score = 46.2 bits (108), Expect = 8e-04
Identities = 22/88 (25%), Positives = 49/88 (55%)
Frame = +2

Query: 5 KMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILI 184
K++ +++EM++ D T +T+ ++ + GL + + F ++ G+ T+N L+
Sbjct: 263 KILGLLDEMRSNGLEFDEFTCSTVISACGREGLLDEARKFFARLKSEGYVAGTFTYNSLL 322

Query: 185 ETYGRLGSAEQALGVYKAMLRASCCPDI 268
+ +G+ G +AL + K M + +C PD+
Sbjct: 323 QVFGKAGIYSEALSILKEMEKNNCPPDL 350



Score = 42.7 bits (99), Expect = 0.009
Identities = 22/68 (32%), Positives = 36/68 (52%)
Frame = +2

Query: 26 EMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLG 205
EMK+C P+ T+N L ++ + G V +++E+M + G P +T+N L+ R G
Sbjct: 480 EMKSCGFEPNRDTFNALIGAYGRCGSQIDVVKMYEEMIKAGFTPCVTTYNALLNALARRG 539

Query: 206 SAEQALGV 229
E A V
Sbjct: 540 DWEAAESV 547



Score = 40.0 bits (92), Expect = 0.057
Identities = 19/68 (27%), Positives = 34/68 (50%)
Frame = +2

Query: 62 TWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGVYKAM 241
T+N+L F + G++S+ + ++M + PD T+N L+ Y R G E+ M
Sbjct: 317 TYNSLLQVFGKAGIYSEALSILKEMEKNNCPPDLVTYNELVAAYVRAGFHEEGADFIDTM 376

Query: 242 LRASCCPD 265
+R P+
Sbjct: 377 IRKGIMPN 384



Score = 40.0 bits (92), Expect = 0.057
Identities = 18/73 (24%), Positives = 42/73 (57%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD+V +N++ + F+++ ++ + ++ +R G +PD T+N L++ Y R G + +
Sbjct: 628 PDLVLFNSMLSIFAKNKMYDRAHEMLRLIRESGLQPDLVTYNSLMDMYARGGECWKGEEI 687

Query: 230 YKAMLRASCCPDI 268
K + ++ PD+
Sbjct: 688 LKGIQKSGGKPDL 700



Score = 38.5 bits (88), Expect = 0.17
Identities = 17/64 (26%), Positives = 34/64 (53%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M EEM P + T+N L N+ ++ G V DM+ G +P+ +++++++ Y
Sbjct: 512 MYEEMIKAGFTPCVTTYNALLNALARRGDWEAAESVILDMKSKGFKPNETSYSLMLNCYA 571

Query: 197 RLGS 208
+ G+
Sbjct: 572 KGGN 575



Score = 37.7 bits (86), Expect = 0.29
Identities = 19/72 (26%), Positives = 33/72 (45%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
PD+V++NT+ F + GL + + +M G P T+N + Y G + V
Sbjct: 698 PDLVSYNTVIKGFCRQGLMQEAIRTLSEMTISGIRPCIVTYNTFVAGYSGKGMFSEVEEV 757

Query: 230 YKAMLRASCCPD 265
M++ C P+
Sbjct: 758 ISYMIQHDCRPN 769



Score = 36.6 bits (83), Expect = 0.64
Identities = 16/72 (22%), Positives = 34/72 (47%)
Frame = +2

Query: 50 PDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGSAEQALGV 229
P+ +T+ T+ N++ + G + F M+ G P+ T+N ++ G+ E+ + +
Sbjct: 383 PNAITYTTVINAYGKAGKEDKALSFFRQMKESGCVPNVCTYNAILGMLGKKSRLEEMIDM 442

Query: 230 YKAMLRASCCPD 265
M C P+
Sbjct: 443 LCDMRSNGCAPN 454



Score = 36.6 bits (83), Expect = 0.64
Identities = 19/84 (22%), Positives = 46/84 (54%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
M+ ++ PD+VT+N+L + +++ G + ++ + +++ G +PD ++N +I+ +
Sbjct: 652 MLRLIRESGLQPDLVTYNSLMDMYARGGECWKGEEILKGIQKSGGKPDLVSYNTVIKGFC 711

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G ++A+ M + P I
Sbjct: 712 RQGLMQEAIRTLSEMTISGIRPCI 735



Score = 34.7 bits (78), Expect = 2.4
Identities = 18/58 (31%), Positives = 30/58 (51%)
Frame = +2

Query: 20 VEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETY 193
+ EM P IVT+NT +S G+ S+V +V M + P+ T+ I+++ Y
Sbjct: 723 LSEMTISGIRPCIVTYNTFVAGYSGKGMFSEVEEVISYMIQHDCRPNELTYKIVVDGY 780


>tr|Q6H7X0|Q6H7X0_ORYSJ Os02g0170000 protein OS=Oryza sativa subsp.
japonica GN=OJ1116_A06.10 PE=4 SV=1
Length = 397

Score = 72.4 bits (176), Expect = 1e-11
Identities = 33/85 (38%), Positives = 50/85 (58%)
Frame = +2

Query: 11 MLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIET 190
M + EMK+ C P+I T+ L N+F++ GL + +VFE+M++ GHEPD +N L+E
Sbjct: 102 MKVFNEMKSIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEA 161

Query: 191 YGRLGSAEQALGVYKAMLRASCCPD 265
Y R G + A ++ M C PD
Sbjct: 162 YSRAGLPQGASEIFSLMQHMGCEPD 186



Score = 61.6 bits (148), Expect = 2e-08
Identities = 29/87 (33%), Positives = 50/87 (57%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK + EEM+ PD+ +N L ++S+ GL +++F M+ +G EPD +++NIL
Sbjct: 134 EKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMGCEPDRASYNIL 193

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCP 262
++ YGR G E A V++ + + P
Sbjct: 194 VDAYGRAGLHEDAEAVFEELKQRGMSP 220



Score = 45.4 bits (106), Expect = 0.001
Identities = 21/79 (26%), Positives = 41/79 (51%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
M+ C PD ++N L +++ + GLH VFE++++ G P + +L+ + R G+
Sbjct: 178 MQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHMLLLAAHARSGN 237

Query: 209 AEQALGVYKAMLRASCCPD 265
A + V + ++ PD
Sbjct: 238 ATRCEEVMAQLHKSGLTPD 256



Score = 36.2 bits (82), Expect = 0.83
Identities = 17/84 (20%), Positives = 37/84 (44%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ EM+ P+ +N + + + +V++ M+R + TF ++I YG
Sbjct: 34 VISEMREHGIPPNATVYNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMINVYG 93

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ ++ V+ M C P+I
Sbjct: 94 KAKQPMSSMKVFNEMKSIGCKPNI 117



Score = 35.8 bits (81), Expect = 1.1
Identities = 18/84 (21%), Positives = 38/84 (45%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ ++ PD N + N++++ G + ++F M R G + D T+N+ + YG
Sbjct: 244 VMAQLHKSGLTPDTFALNAMLNAYARAGRLDDMERLFAAMERRG-DADVGTYNVAVNAYG 302

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G + + A+ D+
Sbjct: 303 RAGYVGRMEAAFAAVAARGLAADV 326


>tr|B8AII6|B8AII6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_06020 PE=4 SV=1
Length = 738

Score = 72.4 bits (176), Expect = 1e-11
Identities = 33/85 (38%), Positives = 50/85 (58%)
Frame = +2

Query: 11 MLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIET 190
M + EMK+ C P+I T+ L N+F++ GL + +VFE+M++ GHEPD +N L+E
Sbjct: 443 MKVFNEMKSIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEA 502

Query: 191 YGRLGSAEQALGVYKAMLRASCCPD 265
Y R G + A ++ M C PD
Sbjct: 503 YSRAGLPQGASEIFSLMQHMGCEPD 527



Score = 61.6 bits (148), Expect = 2e-08
Identities = 29/87 (33%), Positives = 50/87 (57%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK + EEM+ PD+ +N L ++S+ GL +++F M+ +G EPD +++NIL
Sbjct: 475 EKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMGCEPDRASYNIL 534

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCP 262
++ YGR G E A V++ + + P
Sbjct: 535 VDAYGRAGLHEDAEAVFEELKQRGMSP 561



Score = 45.4 bits (106), Expect = 0.001
Identities = 21/79 (26%), Positives = 41/79 (51%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
M+ C PD ++N L +++ + GLH VFE++++ G P + +L+ + R G+
Sbjct: 519 MQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHMLLLAAHARSGN 578

Query: 209 AEQALGVYKAMLRASCCPD 265
A + V + ++ PD
Sbjct: 579 ATRCEEVMAQLHKSGLTPD 597



Score = 38.5 bits (88), Expect = 0.17
Identities = 24/83 (28%), Positives = 33/83 (39%), Gaps = 17/83 (20%)
Frame = +2

Query: 65 WNTL*NSFSQHGLHSQVTQVFEDMR-----------------RVGHEPDNSTFNILIETY 193
W +L N S H L + V R R PD +N+LIE+Y
Sbjct: 269 WESLDNIPSTHNLFDDLVNVAVQFRMNKKWDLIIPVCEWILYRSSFRPDIICYNLLIESY 328

Query: 194 GRLGSAEQALGVYKAMLRASCCP 262
G+ +A +Y A+L A C P
Sbjct: 329 GKKRQLNKAESIYMALLEAQCVP 351



Score = 36.2 bits (82), Expect = 0.83
Identities = 17/84 (20%), Positives = 37/84 (44%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ EM+ P+ +N + + + +V++ M+R + TF ++I YG
Sbjct: 375 VISEMREHGIPPNATVYNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMINVYG 434

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ ++ V+ M C P+I
Sbjct: 435 KAKQPMSSMKVFNEMKSIGCKPNI 458



Score = 33.5 bits (75), Expect = 5.4
Identities = 17/84 (20%), Positives = 37/84 (44%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ ++ PD N + N++++ G + ++ M R G + D T+N+ + YG
Sbjct: 585 VMAQLHKSGLTPDTFALNAMLNAYARAGRLDDMERLLAAMERRG-DADVGTYNVAVNAYG 643

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G + + A+ D+
Sbjct: 644 RAGYVGRMEAAFAAVAARGLAADV 667


>tr|A3A3K8|A3A3K8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_005380 PE=4 SV=1
Length = 595

Score = 72.4 bits (176), Expect = 1e-11
Identities = 33/85 (38%), Positives = 50/85 (58%)
Frame = +2

Query: 11 MLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIET 190
M + EMK+ C P+I T+ L N+F++ GL + +VFE+M++ GHEPD +N L+E
Sbjct: 300 MKVFNEMKSIGCKPNICTYTALVNAFAREGLCEKAEEVFEEMQQAGHEPDVYAYNALMEA 359

Query: 191 YGRLGSAEQALGVYKAMLRASCCPD 265
Y R G + A ++ M C PD
Sbjct: 360 YSRAGLPQGASEIFSLMQHMGCEPD 384



Score = 61.6 bits (148), Expect = 2e-08
Identities = 29/87 (33%), Positives = 50/87 (57%)
Frame = +2

Query: 2 EKMMLMVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNIL 181
EK + EEM+ PD+ +N L ++S+ GL +++F M+ +G EPD +++NIL
Sbjct: 332 EKAEEVFEEMQQAGHEPDVYAYNALMEAYSRAGLPQGASEIFSLMQHMGCEPDRASYNIL 391

Query: 182 IETYGRLGSAEQALGVYKAMLRASCCP 262
++ YGR G E A V++ + + P
Sbjct: 392 VDAYGRAGLHEDAEAVFEELKQRGMSP 418



Score = 45.4 bits (106), Expect = 0.001
Identities = 21/79 (26%), Positives = 41/79 (51%)
Frame = +2

Query: 29 MKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYGRLGS 208
M+ C PD ++N L +++ + GLH VFE++++ G P + +L+ + R G+
Sbjct: 376 MQHMGCEPDRASYNILVDAYGRAGLHEDAEAVFEELKQRGMSPTMKSHMLLLAAHARSGN 435

Query: 209 AEQALGVYKAMLRASCCPD 265
A + V + ++ PD
Sbjct: 436 ATRCEEVMAQLHKSGLTPD 454



Score = 38.5 bits (88), Expect = 0.17
Identities = 24/83 (28%), Positives = 33/83 (39%), Gaps = 17/83 (20%)
Frame = +2

Query: 65 WNTL*NSFSQHGLHSQVTQVFEDMR-----------------RVGHEPDNSTFNILIETY 193
W +L N S H L + V R R PD +N+LIE+Y
Sbjct: 126 WESLDNIPSTHNLFDDLVNVAVQFRMNKKWDLIIPVCEWILYRSSFRPDIICYNLLIESY 185

Query: 194 GRLGSAEQALGVYKAMLRASCCP 262
G+ +A +Y A+L A C P
Sbjct: 186 GKKRQLNKAESIYMALLEAQCVP 208



Score = 36.2 bits (82), Expect = 0.83
Identities = 17/84 (20%), Positives = 37/84 (44%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ EM+ P+ +N + + + +V++ M+R + TF ++I YG
Sbjct: 232 VISEMREHGIPPNATVYNAYLDGLLKARCTEKAVEVYQRMKRERCRANTETFTLMINVYG 291

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
+ ++ V+ M C P+I
Sbjct: 292 KAKQPMSSMKVFNEMKSIGCKPNI 315



Score = 35.8 bits (81), Expect = 1.1
Identities = 18/84 (21%), Positives = 38/84 (45%)
Frame = +2

Query: 17 MVEEMKACNCAPDIVTWNTL*NSFSQHGLHSQVTQVFEDMRRVGHEPDNSTFNILIETYG 196
++ ++ PD N + N++++ G + ++F M R G + D T+N+ + YG
Sbjct: 442 VMAQLHKSGLTPDTFALNAMLNAYARAGRLDDMERLFAAMERRG-DADVGTYNVAVNAYG 500

Query: 197 RLGSAEQALGVYKAMLRASCCPDI 268
R G + + A+ D+
Sbjct: 501 RAGYVGRMEAAFAAVAARGLAADV 524