BP919267
Clone id YMU001_000123_B04
Library
Length 531
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000123_B04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTCACTGTTTGCACGAAGTTTCCTCCGTGGTTTGCTCGGCTCATGAGTTGCCAAACCTTT
AGTCCTTCTCTGCAGATTGCCGAGTTTCCAAGCCGTTTCCAAGATGAGCACGACTTCGCG
TCTCTCGTTCAAAAGATTCTACAGGCGTTCCCCTCAGCACATCAGTGTTCCGTATTGTGT
CACGCGAGATACTGACGCACTGCTGATATCTCCTCAACCTGATCTACTTCCTCTTGCTCT
GACAGCCTCTTCGATTGCTGTATCTGATACTTCATTCAACGAAACTTGTGAACCATCGTC
GTTACGCTCACTTAACCCTTTGCTGGCCTCACATATTTCCTTTAAAGCTCTACTAAAATC
TGTGATTGTGTTCTTAACTTGTGATTTAGCAAGCAGACTCTTCTTTGTCTCCGAGGTGAA
TGATTTCACATCTACTGACTGAACAAACCCTATCTGCTTGGTGCCAAAAAAATACACAAA
TACTTTGCGCCGATCTGCAGGATAGCCAAACTCATCTGGATCACTCACCCG
■■Homology search results ■■ -
sp_hit_id Q98PU5
Definition sp|Q98PU5|Y624_MYCPU UPF0082 protein MYPU_6240 OS=Mycoplasma pulmonis
Align length 115
Score (bit) 32.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919267|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_B04.
(531 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q98PU5|Y624_MYCPU UPF0082 protein MYPU_6240 OS=Mycoplasma pul... 32 1.9
sp|Q9VZS5|RL28_DROME 60S ribosomal protein L28 OS=Drosophila mel... 31 3.3
sp|Q5PAY0|PNP_ANAMM Polyribonucleotide nucleotidyltransferase OS... 31 3.3
sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=2 SV=1 31 4.2
sp|Q03156|ALBU2_SALSA Serum albumin 2 OS=Salmo salar GN=alb2 PE=... 31 4.3
sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating pr... 30 7.2

>sp|Q98PU5|Y624_MYCPU UPF0082 protein MYPU_6240 OS=Mycoplasma
pulmonis GN=MYPU_6240 PE=3 SV=1
Length = 241

Score = 32.0 bits (71), Expect = 1.9
Identities = 25/115 (21%), Positives = 53/115 (46%), Gaps = 6/115 (5%)
Frame = +2

Query: 59 LVLLCRLPSFQAVSKMSTTSRLSFKRFYRRSPQHISVPYCVTR----DTDALLISPQPDL 226
++++C +F +++S+ + F + + + S+PY + + D LIS + +
Sbjct: 98 ILVICLSDNF---NRLSSNIKSYFNKAGGQLSKQGSIPYVYQQKGLIEIDKKLIS-EDKI 153

Query: 227 LPLALTASS--IAVSDTSFNETCEPSSLRSLNPLLASHISFKALLKSVIVFLTCD 385
+AL A + I D ++ TCEPSS ++ + F L + ++ D
Sbjct: 154 TEIALEAGAEDIQAEDNYYSITCEPSSFNQVSEFIEKATGFSEFLTREVSYIASD 208


>sp|Q9VZS5|RL28_DROME 60S ribosomal protein L28 OS=Drosophila
melanogaster GN=RpL28 PE=1 SV=1
Length = 144

Score = 31.2 bits (69), Expect = 3.3
Identities = 21/59 (35%), Positives = 29/59 (49%), Gaps = 5/59 (8%)
Frame = -1

Query: 459 KQIGFVQSVDVKSFTSETKKSLLAKSQVKNTI-TDFS----RALKEICEASKGLSERND 298
K +G V + D K FT+ KK A+ KNT+ DF R+LK++ G R D
Sbjct: 51 KTLGVVPAADKKGFTAVLKKGKYAQRPAKNTVRVDFKAGPRRSLKKLKNLLIGSKYRKD 109


>sp|Q5PAY0|PNP_ANAMM Polyribonucleotide nucleotidyltransferase
OS=Anaplasma marginale (strain St. Maries) GN=pnp PE=3
SV=1
Length = 805

Score = 31.2 bits (69), Expect = 3.3
Identities = 18/61 (29%), Positives = 33/61 (54%)
Frame = -1

Query: 429 VKSFTSETKKSLLAKSQVKNTITDFSRALKEICEASKGLSERNDDGSQVSLNEVSDTAIE 250
V+ + ++ K+++KN I + ++EICE + E + DG+ V + VS A+E
Sbjct: 553 VRDHVPRMESMIIDKNKIKNVIGTGGKNVREICEKTGVKIEISQDGT-VMIYAVSRDAVE 611

Query: 249 E 247
E
Sbjct: 612 E 612


>sp|O88799|ZAN_MOUSE Zonadhesin OS=Mus musculus GN=Zan PE=2 SV=1
Length = 5376

Score = 30.8 bits (68), Expect = 4.2
Identities = 17/49 (34%), Positives = 24/49 (48%)
Frame = +2

Query: 149 SPQHISVPYCVTRDTDALLISPQPDLLPLALTASSIAVSDTSFNETCEP 295
SP+ SVP T T+ +SP+ LP + S V++ S ET P
Sbjct: 796 SPEETSVPTEETISTEVTTVSPEETTLPTEVPTVSTEVTNVSPEETSVP 844



Score = 30.8 bits (68), Expect = 4.2
Identities = 17/49 (34%), Positives = 24/49 (48%)
Frame = +2

Query: 149 SPQHISVPYCVTRDTDALLISPQPDLLPLALTASSIAVSDTSFNETCEP 295
SP+ SVP T T+ +SP+ LP + S V++ S ET P
Sbjct: 875 SPEETSVPTEETISTEVTTVSPEETTLPTEVPTVSTEVTNVSPEETSVP 923


>sp|Q03156|ALBU2_SALSA Serum albumin 2 OS=Salmo salar GN=alb2 PE=2
SV=1
Length = 608

Score = 30.8 bits (68), Expect = 4.3
Identities = 19/74 (25%), Positives = 37/74 (50%)
Frame = -1

Query: 504 YPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSRALKEICEA 325
+P ++V + F + +Q D++ +E K+ LA S + ITD + K++C A
Sbjct: 358 HPESSQQVILRFAKEAEQALLQCCDMEDH-AECVKTALAGSDIDKKITDETDYYKKMCAA 416

Query: 324 SKGLSERNDDGSQV 283
+S+ N + S +
Sbjct: 417 EAAVSDDNFEKSMM 430


>sp|Q8N103|TAGAP_HUMAN T-cell activation Rho GTPase-activating
protein OS=Homo sapiens GN=TAGAP PE=2 SV=1
Length = 731

Score = 30.0 bits (66), Expect = 7.2
Identities = 23/69 (33%), Positives = 34/69 (49%)
Frame = +2

Query: 194 DALLISPQPDLLPLALTASSIAVSDTSFNETCEPSSLRSLNPLLASHISFKALLKSVIVF 373
DA +SP+P + +A SS+A D ++E PSS L S ++ + L KS F
Sbjct: 349 DAREVSPEPIVSTVARLKSSLAQPDRRYSEPSMPSS----QECLESRVTNQTLTKSEGDF 404

Query: 374 LTCDLASRL 400
+ SRL
Sbjct: 405 PVPRVGSRL 413


tr_hit_id A7PU75
Definition tr|A7PU75|A7PU75_VITVI Chromosome chr7 scaffold_31, whole genome shotgun sequence OS=Vitis vinifera
Align length 93
Score (bit) 79.0
E-value 1.0e-13
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919267|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_B04.
(531 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PU75|A7PU75_VITVI Chromosome chr7 scaffold_31, whole genome... 79 1e-13
tr|Q8H3E3|Q8H3E3_ORYSJ Transcription factor (PWWP domain protein... 72 1e-11
tr|Q0D412|Q0D412_ORYSJ Os07g0655500 protein OS=Oryza sativa subs... 72 2e-11
tr|B8B5E0|B8B5E0_ORYSI Putative uncharacterized protein OS=Oryza... 72 2e-11
tr|A3BMY9|A3BMY9_ORYSJ Putative uncharacterized protein OS=Oryza... 72 2e-11
tr|Q9LYB5|Q9LYB5_ARATH Putative uncharacterized protein T20O10_1... 69 1e-10
tr|A7P2V8|A7P2V8_VITVI Chromosome chr1 scaffold_5, whole genome ... 69 2e-10
tr|Q8GYT7|Q8GYT7_ARATH Putative uncharacterized protein At2g4816... 67 7e-10
tr|Q10L59|Q10L59_ORYSJ PWWP domain containing protein, expressed... 67 7e-10
tr|B8APU6|B8APU6_ORYSI Putative uncharacterized protein OS=Oryza... 67 7e-10
tr|Q9XER9|Q9XER9_ARATH Putative transcription factor OS=Arabidop... 66 1e-09
tr|Q9LEY4|Q9LEY4_ARATH Putative uncharacterized protein T22D6_17... 64 4e-09
tr|Q60D80|Q60D80_BRAOL Putative PWWP domain-containing protein (... 63 1e-08
tr|Q6Z1Z8|Q6Z1Z8_ORYSJ Os08g0100500 protein OS=Oryza sativa subs... 50 9e-05
tr|B8B9X3|B8B9X3_ORYSI Putative uncharacterized protein OS=Oryza... 50 9e-05
tr|A3BNS1|A3BNS1_ORYSJ Putative uncharacterized protein OS=Oryza... 39 0.13
tr|Q7SAN3|Q7SAN3_NEUCR Putative uncharacterized protein OS=Neuro... 36 1.1
tr|A9SG87|A9SG87_PHYPA Predicted protein OS=Physcomitrella paten... 35 2.4
tr|Q6MFR8|Q6MFR8_NEUCR Adenylyl cyclase-associated protein OS=Ne... 35 3.2
tr|Q0DRT0|Q0DRT0_ORYSJ Os03g0358000 protein OS=Oryza sativa subs... 34 4.1
tr|A9RIA7|A9RIA7_PHYPA Predicted protein OS=Physcomitrella paten... 34 4.1
tr|Q00YT5|Q00YT5_OSTTA Kinesin, putative (ISS) OS=Ostreococcus t... 34 5.3
tr|B6BNY0|B6BNY0_9PROT Methyl-accepting chemotaxis sensory trans... 34 5.4
tr|Q0DRT1|Q0DRT1_ORYSJ Os03g0357800 protein OS=Oryza sativa subs... 34 5.4
tr|Q23T77|Q23T77_TETTH Putative uncharacterized protein OS=Tetra... 34 5.4
tr|B4U5B6|B4U5B6_STREM Putative permease OS=Streptococcus equi s... 33 7.0
tr|B6LCE6|B6LCE6_BRAFL Putative uncharacterized protein OS=Branc... 33 9.0
tr|A7Q244|A7Q244_VITVI Chromosome chr13 scaffold_45, whole genom... 33 9.2
tr|B4K805|B4K805_DROMO GI24210 OS=Drosophila mojavensis GN=GI242... 33 9.2

>tr|A7PU75|A7PU75_VITVI Chromosome chr7 scaffold_31, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023685001
PE=4 SV=1
Length = 1131

Score = 79.0 bits (193), Expect = 1e-13
Identities = 44/93 (47%), Positives = 60/93 (64%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
VS+P+++GY AD RKV VYFFGTKQI F DV+ FT E K+SLL K Q K DF R
Sbjct: 43 VSEPEKWGYSADWRKVLVYFFGTKQIAFCNPADVEEFTEEKKESLLTKRQGKG--ADFVR 100

Query: 348 ALKEICEASKGLSERNDDGSQVSLNEVSDTAIE 250
A++EI ++ + L +++ S N+V+ T E
Sbjct: 101 AVQEIVDSYEELKKQDQVDDFNSANDVAVTNSE 133


>tr|Q8H3E3|Q8H3E3_ORYSJ Transcription factor (PWWP domain
protein)-like protein OS=Oryza sativa subsp. japonica
GN=P0018C07.118 PE=4 SV=1
Length = 1449

Score = 72.4 bits (176), Expect = 1e-11
Identities = 38/87 (43%), Positives = 55/87 (63%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
VS+P+++G + ++K+ VYF+GTKQI F D+++FT E +KSLLAK K DF R
Sbjct: 43 VSEPEKWGLSSAKKKLLVYFYGTKQIAFCNYTDLEAFTEEKRKSLLAKRHGKG--ADFVR 100

Query: 348 ALKEICEASKGLSERNDDGSQVSLNEV 268
A+KEI E L N++ S S +V
Sbjct: 101 AVKEIVEIYDSLKNENNNKSDTSGTDV 127


>tr|Q0D412|Q0D412_ORYSJ Os07g0655500 protein OS=Oryza sativa subsp.
japonica GN=Os07g0655500 PE=4 SV=1
Length = 1447

Score = 72.0 bits (175), Expect = 2e-11
Identities = 37/87 (42%), Positives = 55/87 (63%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
+S+P+++G + ++K+ VYF+GTKQI F D+++FT E +KSLLAK K DF R
Sbjct: 43 ISEPEKWGLSSAKKKLLVYFYGTKQIAFCNYTDLEAFTEEKRKSLLAKRHGKG--ADFVR 100

Query: 348 ALKEICEASKGLSERNDDGSQVSLNEV 268
A+KEI E L N++ S S +V
Sbjct: 101 AVKEIVEIYDSLKNENNNKSDTSGTDV 127


>tr|B8B5E0|B8B5E0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_27156 PE=4 SV=1
Length = 1484

Score = 72.0 bits (175), Expect = 2e-11
Identities = 37/87 (42%), Positives = 55/87 (63%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
+S+P+++G + ++K+ VYF+GTKQI F D+++FT E +KSLLAK K DF R
Sbjct: 50 ISEPEKWGLSSAKKKLLVYFYGTKQIAFCNYTDLEAFTEEKRKSLLAKRHGKG--ADFVR 107

Query: 348 ALKEICEASKGLSERNDDGSQVSLNEV 268
A+KEI E L N++ S S +V
Sbjct: 108 AVKEIVEIYDSLKNENNNKSDTSGTDV 134


>tr|A3BMY9|A3BMY9_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024411 PE=4 SV=1
Length = 1527

Score = 72.0 bits (175), Expect = 2e-11
Identities = 37/87 (42%), Positives = 55/87 (63%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
+S+P+++G + ++K+ VYF+GTKQI F D+++FT E +KSLLAK K DF R
Sbjct: 68 ISEPEKWGLSSAKKKLLVYFYGTKQIAFCNYTDLEAFTEEKRKSLLAKRHGKG--ADFVR 125

Query: 348 ALKEICEASKGLSERNDDGSQVSLNEV 268
A+KEI E L N++ S S +V
Sbjct: 126 AVKEIVEIYDSLKNENNNKSDTSGTDV 152


>tr|Q9LYB5|Q9LYB5_ARATH Putative uncharacterized protein T20O10_170
OS=Arabidopsis thaliana GN=T20O10_170 PE=4 SV=1
Length = 1261

Score = 69.3 bits (168), Expect = 1e-10
Identities = 35/76 (46%), Positives = 53/76 (69%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
V +P+++G+ AD +KV V+FFGT+QI F DV+SFT E K+SLL + K +DF R
Sbjct: 42 VDEPEKWGHSADSKKVTVHFFGTQQIAFCNHGDVESFTEEKKQSLLTRRHAKG--SDFVR 99

Query: 348 ALKEICEASKGLSERN 301
A+KEI E+ + L +++
Sbjct: 100 AVKEITESYEKLKQQD 115


>tr|A7P2V8|A7P2V8_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030203001
PE=4 SV=1
Length = 1395

Score = 68.6 bits (166), Expect = 2e-10
Identities = 33/82 (40%), Positives = 55/82 (67%)
Frame = -1

Query: 531 RVSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFS 352
++ P+++ D +K FV FFGT++I FV D+++FTSE K L A+ + K T+ F+
Sbjct: 37 KIGKPEDWDRTPDPKKYFVQFFGTEEIAFVAPGDIEAFTSEVKNKLSARCRGK-TVKFFA 95

Query: 351 RALKEICEASKGLSERNDDGSQ 286
+A+KEIC+A + L ++N GS+
Sbjct: 96 QAVKEICDAYEELQQKNTSGSR 117


>tr|Q8GYT7|Q8GYT7_ARATH Putative uncharacterized protein At2g48160
OS=Arabidopsis thaliana GN=At2g48160 PE=2 SV=1
Length = 1366

Score = 66.6 bits (161), Expect = 7e-10
Identities = 36/86 (41%), Positives = 53/86 (61%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
VS+P+++ D +KVFV+FFGT+QI F DV++FT E K+SLL + K +DF R
Sbjct: 42 VSEPEKWDASPDSKKVFVHFFGTQQIAFCNPGDVEAFTEERKQSLLTRRHAKG--SDFVR 99

Query: 348 ALKEICEASKGLSERNDDGSQVSLNE 271
A+KEI E+ + L ++ S E
Sbjct: 100 AVKEIIESYEKLKQQERASDPKSAEE 125


>tr|Q10L59|Q10L59_ORYSJ PWWP domain containing protein, expressed
OS=Oryza sativa subsp. japonica GN=LOC_Os03g24339 PE=4
SV=1
Length = 1493

Score = 66.6 bits (161), Expect = 7e-10
Identities = 32/74 (43%), Positives = 50/74 (67%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
+S+P+++G + ++K+ VYF+GTKQI F D+++FT E ++SLLAK Q K +DF R
Sbjct: 49 ISEPEQWGQTSVKKKILVYFYGTKQIAFCNYADLEAFTEEKRRSLLAKRQGKG--SDFLR 106

Query: 348 ALKEICEASKGLSE 307
A+ EI + L E
Sbjct: 107 AVDEIIDVYDSLKE 120


>tr|B8APU6|B8APU6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_11635 PE=4 SV=1
Length = 1472

Score = 66.6 bits (161), Expect = 7e-10
Identities = 32/74 (43%), Positives = 50/74 (67%)
Frame = -1

Query: 528 VSDPDEFGYPADRRKVFVYFFGTKQIGFVQSVDVKSFTSETKKSLLAKSQVKNTITDFSR 349
+S+P+++G + ++K+ VYF+GTKQI F D+++FT E ++SLLAK Q K +DF R
Sbjct: 47 ISEPEQWGQTSVKKKILVYFYGTKQIAFCNYADLEAFTEEKRRSLLAKRQGKG--SDFVR 104

Query: 348 ALKEICEASKGLSE 307
A+ EI + L E
Sbjct: 105 AVDEIIDVYDSLKE 118