BP919280
Clone id YMU001_000123_C06
Library
Length 499
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000123_C06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAAGCGATCTATCCGCGATAGATTCACTCCTCCCACCTTGCAGTCCGAACGAGAGAAGGC
CAAAGCTGTCTGGGGGCCTCACAAAACTAGAGTGCTGCCACACATCCAAGATCCTCAGAG
GCATACAGAACCTCTCCCAAGCTGCCAGCCCAACTCCATGCACAGTAGCATGGCTACCAC
TAATCTTGTCAGAAGGGTCCTCCAACATGTTGAGGTCCCCCCCTATGCACCAGTGTTCTG
TCTGCGGCAGAGACTCAACTATCTGTGACCAAAACTCTGCTCGTGCACTCGCCACATTGG
GCGCATAGATGTTCAGGAAGCTTAAAAGGAAACCCTGAAATTGCATAGTGATGGACTGAG
CCCTGCCTGGCACAATAATCCCTCTGCCCACAATGGCCTGCTGCAAAGAGTCCGGAATAG
TCATACATACCCCACCCTGGATGCCTCTAGGTCCAAAAGCAGCTGACCAAAAAGTATCAT
ATCGTCCAGCACATGAGCC
■■Homology search results ■■ -
sp_hit_id P14381
Definition sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa protein OS=Xenopus laevis
Align length 86
Score (bit) 48.1
E-value 2.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919280|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_C06.
(499 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa prot... 48 2e-05
sp|P41230|JAD1C_MOUSE Histone demethylase JARID1C OS=Mus musculu... 33 0.95
sp|A1YVX4|JAD1C_PIG Histone demethylase JARID1C OS=Sus scrofa GN... 32 1.2
sp|Q38JA7|JAD1C_CANFA Histone demethylase JARID1C OS=Canis famil... 32 1.2
sp|Q89WV5|ACSA_BRAJA Acetyl-coenzyme A synthetase OS=Bradyrhizob... 32 2.1
sp|Q88A79|PQQF_PSESM Coenzyme PQQ synthesis protein F OS=Pseudom... 31 2.8
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas... 31 2.8
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas... 31 2.8
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas... 31 2.8
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomo... 31 3.6
sp|A5X7A0|SOBPA_DANRE Sine oculis-binding protein homolog OS=Dan... 30 4.7
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudo... 30 4.7
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingo... 30 4.7
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizob... 30 4.7
sp|P41229|JAD1C_HUMAN Histone demethylase JARID1C OS=Homo sapien... 30 6.1
sp|Q55BQ3|SCY2_DICDI Probable inactive serine/threonine-protein ... 30 8.0
sp|A1DDY6|IRS4_NEOFI Increased rDNA silencing protein 4 OS=Neosa... 30 8.2

>sp|P14381|YTX2_XENLA Transposon TX1 uncharacterized 149 kDa protein
OS=Xenopus laevis PE=4 SV=1
Length = 1308

Score = 48.1 bits (113), Expect = 2e-05
Identities = 26/86 (30%), Positives = 41/86 (47%), Gaps = 3/86 (3%)
Frame = -1

Query: 433 GVCMTIPDSLQQAIVGRGIIVPGRAQSITMQFQGFLLSFLNIYAPNVASARAEFW---SQ 263
GV DS Q ++ ++PGR + ++ G + +N+YAP RA F+ S
Sbjct: 68 GVVTLFSDSFQPEVLSATSVIPGRLLHLRVRESGRTYNLMNVYAPTTGPERARFFESLSA 127

Query: 262 IVESLPQTEHWCIGGDLNMLEDPSDK 185
+E++ E IGGD N D D+
Sbjct: 128 YMETIDSDEALIIGGDFNYTLDARDR 153


>sp|P41230|JAD1C_MOUSE Histone demethylase JARID1C OS=Mus musculus
GN=Jarid1c PE=2 SV=4
Length = 1554

Score = 32.7 bits (73), Expect = 0.95
Identities = 24/86 (27%), Positives = 33/86 (38%), Gaps = 5/86 (5%)
Frame = +3

Query: 33 PPCSPNERRPKLSGGLTKLECCHTSKILRGIQNLSQAASPTPCTVAWLPLILSEGSSNML 212
P C P + GG K+E L G + LS SP PCT + L + ++ +
Sbjct: 265 PECPPTVVVKEELGGDVKMESTSPKTFLEGKEELSH--SPEPCTKMTMRLRRNHSNAQFI 322

Query: 213 RSPPMHQCSVCGRDSTI-----CDQN 275
S CS D + CD N
Sbjct: 323 ESYVCRMCSRGDEDDKLLLCDGCDDN 348


>sp|A1YVX4|JAD1C_PIG Histone demethylase JARID1C OS=Sus scrofa
GN=JARID1C PE=2 SV=1
Length = 1516

Score = 32.3 bits (72), Expect = 1.2
Identities = 24/86 (27%), Positives = 33/86 (38%), Gaps = 5/86 (5%)
Frame = +3

Query: 33 PPCSPNERRPKLSGGLTKLECCHTSKILRGIQNLSQAASPTPCTVAWLPLILSEGSSNML 212
P C P + SGG K+E L + LS SP PCT + L + ++ +
Sbjct: 224 PECPPTVVVKEESGGDVKVESTSPKTFLESKEELSH--SPEPCTKMTMRLRRNHSNAQFI 281

Query: 213 RSPPMHQCSVCGRDSTI-----CDQN 275
S CS D + CD N
Sbjct: 282 ESYVCRMCSRGDEDDKLLLCDGCDDN 307


>sp|Q38JA7|JAD1C_CANFA Histone demethylase JARID1C OS=Canis
familiaris GN=JARID1C PE=2 SV=1
Length = 1556

Score = 32.3 bits (72), Expect = 1.2
Identities = 24/86 (27%), Positives = 33/86 (38%), Gaps = 5/86 (5%)
Frame = +3

Query: 33 PPCSPNERRPKLSGGLTKLECCHTSKILRGIQNLSQAASPTPCTVAWLPLILSEGSSNML 212
P C P + SGG K+E L + LS SP PCT + L + ++ +
Sbjct: 265 PECPPTVVVKEESGGDVKVESTSPKTFLESKEELSH--SPEPCTKMTMRLRRNHSNAQFI 322

Query: 213 RSPPMHQCSVCGRDSTI-----CDQN 275
S CS D + CD N
Sbjct: 323 ESYVCRMCSRGDEDDKLLLCDGCDDN 348


>sp|Q89WV5|ACSA_BRAJA Acetyl-coenzyme A synthetase OS=Bradyrhizobium
japonicum GN=acsA PE=1 SV=2
Length = 648

Score = 31.6 bits (70), Expect = 2.1
Identities = 13/37 (35%), Positives = 22/37 (59%)
Frame = -3

Query: 374 CARQGSVHHYAISGFPFKLPEHLCAQCGECTSRVLVT 264
CAR G++H +GF P+ L + +C S+V++T
Sbjct: 151 CARIGAIHSVVFAGFS---PDSLAQRINDCQSKVIIT 184


>sp|Q88A79|PQQF_PSESM Coenzyme PQQ synthesis protein F
OS=Pseudomonas syringae pv. tomato GN=pqqF PE=3 SV=1
Length = 779

Score = 31.2 bits (69), Expect = 2.8
Identities = 19/53 (35%), Positives = 30/53 (56%), Gaps = 1/53 (1%)
Frame = +3

Query: 18 IDSLLP-PCSPNERRPKLSGGLTKLECCHTSKILRGIQNLSQAASPTPCTVAW 173
+D+L+P P S + RR L+ GL+ + CH S++ R +L AA +AW
Sbjct: 1 MDALMPAPQSADLRRITLANGLS-VALCHDSRLKRSAASLRVAAGSHDAPLAW 52


>sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas
syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1
Length = 651

Score = 31.2 bits (69), Expect = 2.8
Identities = 14/37 (37%), Positives = 22/37 (59%)
Frame = -3

Query: 374 CARQGSVHHYAISGFPFKLPEHLCAQCGECTSRVLVT 264
CAR G++H GF PE L + +C+S+V++T
Sbjct: 152 CARIGAIHSVVFGGFS---PEALAGRIIDCSSKVVIT 185


>sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas
syringae pv. tomato GN=acsA PE=3 SV=1
Length = 651

Score = 31.2 bits (69), Expect = 2.8
Identities = 14/37 (37%), Positives = 22/37 (59%)
Frame = -3

Query: 374 CARQGSVHHYAISGFPFKLPEHLCAQCGECTSRVLVT 264
CAR G++H GF PE L + +C+S+V++T
Sbjct: 152 CARIGAIHSVVFGGFS---PEALAGRIIDCSSKVVIT 185


>sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas
syringae pv. phaseolicola (strain 1448A / Race 6)
GN=acsA PE=3 SV=1
Length = 651

Score = 31.2 bits (69), Expect = 2.8
Identities = 14/37 (37%), Positives = 22/37 (59%)
Frame = -3

Query: 374 CARQGSVHHYAISGFPFKLPEHLCAQCGECTSRVLVT 264
CAR G++H GF PE L + +C+S+V++T
Sbjct: 152 CARIGAIHSVVFGGFS---PEALAGRIIDCSSKVVIT 185


>sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas
putida (strain KT2440) GN=acsA1 PE=3 SV=1
Length = 653

Score = 30.8 bits (68), Expect = 3.6
Identities = 18/48 (37%), Positives = 25/48 (52%), Gaps = 1/48 (2%)
Frame = -3

Query: 374 CARQGSVHHYAISGFPFKLPEHLCAQCGECTSRVLVT-DS*VSAADRT 234
CAR G++H GF PE L + +C S+V++T D V RT
Sbjct: 152 CARIGAIHSVVFGGFS---PEALAGRIIDCKSKVVITADEGVRGGRRT 196


tr_hit_id A9S5A5
Definition tr|A9S5A5|A9S5A5_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 121
Score (bit) 64.7
E-value 2.0e-09
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919280|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_C06.
(499 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S5A5|A9S5A5_PHYPA Predicted protein OS=Physcomitrella paten... 65 2e-09
tr|A9SVI1|A9SVI1_PHYPA Predicted protein OS=Physcomitrella paten... 59 1e-07
tr|A9SSN9|A9SSN9_PHYPA Predicted protein OS=Physcomitrella paten... 52 1e-05
tr|A9S0B7|A9S0B7_PHYPA Predicted protein OS=Physcomitrella paten... 50 8e-05
tr|A9S889|A9S889_PHYPA Predicted protein OS=Physcomitrella paten... 48 2e-04
tr|A5C2T1|A5C2T1_VITVI Putative uncharacterized protein OS=Vitis... 48 3e-04
tr|A5ALM2|A5ALM2_VITVI Putative uncharacterized protein OS=Vitis... 47 4e-04
tr|A5C3T9|A5C3T9_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A9SP32|A9SP32_PHYPA Predicted protein OS=Physcomitrella paten... 47 7e-04
tr|A7PYK4|A7PYK4_VITVI Chromosome chr12 scaffold_38, whole genom... 47 7e-04
tr|A5BCI7|A5BCI7_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|A5AK27|A5AK27_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|A5BS85|A5BS85_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5AQQ5|A5AQQ5_VITVI Putative uncharacterized protein OS=Vitis... 46 0.001
tr|A5C9W0|A5C9W0_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A5C6T2|A5C6T2_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A5BTG1|A5BTG1_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A7QQW8|A7QQW8_VITVI Chromosome undetermined scaffold_145, who... 45 0.002
tr|A5B9I8|A5B9I8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5AXY8|A5AXY8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5AE29|A5AE29_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A9RC09|A9RC09_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|A5C8Q9|A5C8Q9_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BDJ8|A5BDJ8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5AUM2|A5AUM2_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A7QMU5|A7QMU5_VITVI Chromosome chr14 scaffold_128, whole geno... 44 0.003
tr|A5C614|A5C614_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003
tr|A5BUT3|A5BUT3_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003
tr|A5BSZ6|A5BSZ6_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003
tr|A5BNY2|A5BNY2_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003

>tr|A9S5A5|A9S5A5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_74774 PE=4 SV=1
Length = 441

Score = 64.7 bits (156), Expect = 2e-09
Identities = 37/121 (30%), Positives = 59/121 (48%), Gaps = 2/121 (1%)
Frame = -1

Query: 439 QGGVCMTIPDSLQQAIVGRGIIVPGRAQSITMQFQGFL-LSFLNIYAPNVASARAEFWSQ 263
+GG + + I G+IV GRAQ +T+Q + + +N+YA N +R W++
Sbjct: 108 KGGTSFLLSARIANLICEHGVIVRGRAQYVTIQVSPHVKVGIINVYAFNYTGSRKRLWNK 167

Query: 262 IVESLPQTEHWCIGGDLNMLEDPSDKISGSHATVHG-VGLAAWERFCMPLRILDVWQHSS 86
I + +W +GGD NM+E SD+ G T G L AW + L + D ++
Sbjct: 168 ISQYPLPAANWILGGDFNMIEQLSDEQGGQDTTGRGRRELIAWNGLLVQLGLQDCFKADE 227

Query: 85 F 83
F
Sbjct: 228 F 228


>tr|A9SVI1|A9SVI1_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_166786 PE=4 SV=1
Length = 623

Score = 59.3 bits (142), Expect = 1e-07
Identities = 37/124 (29%), Positives = 61/124 (49%), Gaps = 3/124 (2%)
Frame = -1

Query: 439 QGGVCMTIPDSLQQAIVGRGIIVPGRAQSITMQFQGFL---LSFLNIYAPNVASARAEFW 269
+G VC + + L + GII+ RA + ++F L + +N+YAPN ++ R + W
Sbjct: 382 KGEVCTLVDNRLHPLVEDIGIIMENRA--VWIKFSDTLGGDIGLVNLYAPNCSTERVQLW 439

Query: 268 SQIVESLPQTEHWCIGGDLNMLEDPSDKISGSHATVHGVGLAAWERFCMPLRILDVWQHS 89
++V +LP W I GD NM+ DK S + G AWE F ++ D ++
Sbjct: 440 HKLVSNLPINCQWHIAGDFNMM----DKSSQCGRLLSGGEKFAWESFRSNFQVTDPFKFQ 495

Query: 88 SFVR 77
+R
Sbjct: 496 GKLR 499


>tr|A9SSN9|A9SSN9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_166348 PE=4 SV=1
Length = 816

Score = 52.4 bits (124), Expect = 1e-05
Identities = 28/92 (30%), Positives = 43/92 (46%), Gaps = 1/92 (1%)
Frame = -1

Query: 442 IQGGVCMTIPDSLQQAIVGRGIIVPGRAQSITMQFQGFL-LSFLNIYAPNVASARAEFWS 266
+ GG + L I G+IV G+AQ +F + + +N+Y N RA W
Sbjct: 653 LAGGTAILTSSKLAPLIQEHGVIVRGQAQYAVFEFTPTMRIGIINVYGYNHTGPRARLWQ 712

Query: 265 QIVESLPQTEHWCIGGDLNMLEDPSDKISGSH 170
+I + W +GGDLN +E DK G++
Sbjct: 713 KITDYPLPPALWIMGGDLNFIESLEDKQGGNN 744


>tr|A9S0B7|A9S0B7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_72904 PE=4 SV=1
Length = 892

Score = 49.7 bits (117), Expect = 8e-05
Identities = 34/120 (28%), Positives = 52/120 (43%), Gaps = 2/120 (1%)
Frame = -1

Query: 436 GGVCMTIPDSLQQAIVGRGIIVPGRAQSITMQFQGFLLSFLNIYAPNVASARAEFWSQIV 257
GG + I D + + G+I+PGRAQ+ W++I
Sbjct: 525 GGTALLISDRITSMVKEHGVIIPGRAQT-------------------------RLWNKIR 559

Query: 256 E-SLPQTEHWCIGGDLNMLEDPSDKISGSHATVHGV-GLAAWERFCMPLRILDVWQHSSF 83
LPQ +W +GGD N++ED DK+ G +T G L AW + L I D ++ +
Sbjct: 560 NYPLPQA-NWILGGDFNIIEDLDDKMGGQASTGRGQRELTAWGALVVHLGICDCFRADEY 618


>tr|A9S889|A9S889_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_75875 PE=4 SV=1
Length = 463

Score = 48.1 bits (113), Expect = 2e-04
Identities = 28/86 (32%), Positives = 41/86 (47%), Gaps = 1/86 (1%)
Frame = -1

Query: 409 SLQQAIVGRGIIVPGRAQSITMQFQGF-LLSFLNIYAPNVASARAEFWSQIVESLPQTEH 233
++ +I G+IV GRAQ +T F + LNIY + A W +I +
Sbjct: 213 AITNSICEHGVIVQGRAQYLTYLNSAFEKVGILNIYGYSYIGPGASLWQKIADFPLSETK 272

Query: 232 WCIGGDLNMLEDPSDKISGSHATVHG 155
W + G N +ED SDK+ G+ T G
Sbjct: 273 WIMMGHCNSIEDLSDKLGGNPTTGKG 298


>tr|A5C2T1|A5C2T1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_007637 PE=4 SV=1
Length = 1676

Score = 47.8 bits (112), Expect = 3e-04
Identities = 32/100 (32%), Positives = 49/100 (49%), Gaps = 5/100 (5%)
Frame = -1

Query: 448 RGIQGGVCMTIPD---SLQQAIVGRGIIVPGRAQSITMQFQGFLLSFLNIYAPNVASARA 278
RG GGV + + L++ VG+ V R +S GF F +Y P + R
Sbjct: 654 RGTAGGVLVFWDNRVLQLEEMEVGK-FTVSCRFKSCE---DGFCWCFTGVYGPTAKAERE 709

Query: 277 EFWSQI--VESLPQTEHWCIGGDLNMLEDPSDKISGSHAT 164
+FWS++ ++ L E WC+ GD NM+ PS++ G T
Sbjct: 710 DFWSELGAIKGL-WNEPWCVAGDFNMIRFPSERSRGGRLT 748


>tr|A5ALM2|A5ALM2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_033248 PE=4 SV=1
Length = 954

Score = 47.4 bits (111), Expect = 4e-04
Identities = 24/70 (34%), Positives = 39/70 (55%), Gaps = 6/70 (8%)
Frame = -1

Query: 355 SITMQFQ----GFLLSFLNIYAPNVASARAEFWSQI--VESLPQTEHWCIGGDLNMLEDP 194
SI+ +F+ GF +F +Y P + R FW ++ + L T+ WCIGGD NM+ P
Sbjct: 429 SISCRFKNVEDGFRWTFSRVYGPTLKRYREAFWEELRAIRGL-WTDPWCIGGDFNMIRFP 487

Query: 193 SDKISGSHAT 164
+++I G +
Sbjct: 488 NERIRGGRVS 497


>tr|A5C3T9|A5C3T9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_000598 PE=4 SV=1
Length = 2691

Score = 47.0 bits (110), Expect = 5e-04
Identities = 20/50 (40%), Positives = 29/50 (58%), Gaps = 1/50 (2%)
Frame = -1

Query: 310 IYAPNVASARAEFWSQIVESLPQT-EHWCIGGDLNMLEDPSDKISGSHAT 164
+Y PN S R EFW ++ + T WC+GGD N++ S+K+ GS T
Sbjct: 1629 VYGPNNPSIRKEFWXELSDLFGLTYPSWCVGGDFNVIRRRSEKLGGSRVT 1678


>tr|A9SP32|A9SP32_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_82018 PE=4 SV=1
Length = 248

Score = 46.6 bits (109), Expect = 7e-04
Identities = 30/124 (24%), Positives = 52/124 (41%), Gaps = 2/124 (1%)
Frame = -1

Query: 442 IQGGVCMTIPDSLQQAIVGRGIIVPGRAQSITMQFQGFL-LSFLNIYAPNVASARAEFWS 266
+ GG + I + G+IV RAQ ++ L +NIY N R W
Sbjct: 82 LTGGTVILIFTKFTPTLQDYGVIVKDRAQYAIIELTPTTRLGIINIYGYNHTGPRTRLWQ 141

Query: 265 QIVESLPQTEHWCIGGDLNMLEDPSDKISGSHATVHGV-GLAAWERFCMPLRILDVWQHS 89
Q + W +GG+ + +E DK G++ HG +A+W + L++ ++
Sbjct: 142 QTADHPLPPALWIMGGNFSFVESLEDKQGGNNNLGHGFREVASWNNLLIRLQLQALFHMD 201

Query: 88 SFVR 77
F +
Sbjct: 202 EFCK 205


>tr|A7PYK4|A7PYK4_VITVI Chromosome chr12 scaffold_38, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00026475001
PE=4 SV=1
Length = 1442

Score = 46.6 bits (109), Expect = 7e-04
Identities = 20/50 (40%), Positives = 30/50 (60%), Gaps = 1/50 (2%)
Frame = -1

Query: 310 IYAPNVASARAEFWSQIVESLPQT-EHWCIGGDLNMLEDPSDKISGSHAT 164
+Y PN +S R EFW ++++ T WC+GGD N++ S K+ GS T
Sbjct: 108 VYGPNNSSIRKEFWVELLDLFGLTYPSWCVGGDFNVIRRRSKKLGGSGVT 157