BP919295
Clone id YMU001_000123_D09
Library
Length 539
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000123_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTCGCGGCCGCGAATTCTTCCAGTGTAAAGTCAAAAGTAAGCATATGATATAGAAAGTA
CTCAAGTGCCTGACAACCATTGAGAAAACTCGAAAGCTTGCAGTAAGCTTGGAGTGGGCT
TTGGAACATACATGAGAAGTGAGACACTACGTAGGCCTAATGTATACACTATTAACGGCG
CGGGAAACGTCACACAAGGAAATTAAAGAGGATGCGTACACACCGGACAGAAGACGCGCT
CGGACGAAGCAGCTGCCTTGAGTTAGTGAGGGTGGCCCGGACCCTTGCCGTAGCCGACGC
CCTTCTTGTGGTGGTAGCCGCCCTTCTTGTACCCTTTCTTGTAAGGGTAATGACCTTTCT
TGGCCCACAACTCGGCCTCCTCACCTGCTTCTGCCCCTGCCCCAGCCACTAATTTACGCC
CCACTTCCTCCACCTCAGCATTAGCAACGCTGCTCATGTATGCCACCAGCATCACCACTA
CTATCACCAGCATGCACGTTATCTTCTTAGAAGCCATGACTAACACTTGATGGTACGAG
■■Homology search results ■■ -
sp_hit_id Q7ZZH7
Definition sp|Q7ZZH7|DBF4A_XENLA Protein DBF4 homolog A OS=Xenopus laevis
Align length 76
Score (bit) 29.6
E-value 8.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919295|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_D09.
(514 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q7ZZH7|DBF4A_XENLA Protein DBF4 homolog A OS=Xenopus laevis G... 30 8.5

>sp|Q7ZZH7|DBF4A_XENLA Protein DBF4 homolog A OS=Xenopus laevis
GN=dbf4 PE=1 SV=1
Length = 661

Score = 29.6 bits (65), Expect = 8.5
Identities = 17/76 (22%), Positives = 36/76 (47%), Gaps = 2/76 (2%)
Frame = +3

Query: 9 KSKHMI*KVLKCLTTIEKTRKLAVSLEWALE--HT*EVRHYVGLMYTLLTARETSHKEIK 182
+ K ++ + +K + K L+ +L W ++ H E +HY+ T L S +K
Sbjct: 120 RGKSLVKRAIKEQEILPKNSILSNALNWGVKILHVEEAKHYIEKKKTALQQVRKSQPVVK 179

Query: 183 EDAYTPDRRRARTKQL 230
++ RR+ + ++L
Sbjct: 180 VESKPQTRRKVKPQKL 195


tr_hit_id Q4SMZ1
Definition tr|Q4SMZ1|Q4SMZ1_TETNG DNA polymerase (Fragment) OS=Tetraodon nigroviridis
Align length 63
Score (bit) 33.1
E-value 8.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919295|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_D09.
(514 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q4SMZ1|Q4SMZ1_TETNG DNA polymerase (Fragment) OS=Tetraodon ni... 33 8.3

>tr|Q4SMZ1|Q4SMZ1_TETNG DNA polymerase (Fragment) OS=Tetraodon
nigroviridis GN=GSTENG00015518001 PE=3 SV=1
Length = 1753

Score = 33.1 bits (74), Expect = 8.3
Identities = 25/63 (39%), Positives = 30/63 (47%)
Frame = -1

Query: 331 RSLPLQERVQEGRLPPQEGRRLRQGSGPPSLTQGSCFVRARLLSGVYASSLISLCDVSRA 152
R +P E E + PPQ R + GSGPPSL G A L G + S IS SR
Sbjct: 699 RPVPQPEDGAEPQEPPQRDR-VPGGSGPPSLPHGQSCASA-ALPGAFLRSDISFYGCSRR 756

Query: 151 VNS 143
V +
Sbjct: 757 VGA 759