BP919298
Clone id YMU001_000123_D12
Library
Length 496
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000123_D12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CATTAATTTCAAACAAAGGGGTAGCATCTTCATGGCTAAAAACTAAGAAGTCTACCACTC
TTTTGTTACACCTTCCTATAAAGAAAACCATGATTGCAACCACTTTAGCACACACACTCA
CACATGCGCGCACGCGCACACGGGGGTGACCTTAACAAAGAGTGCAAACAAGGACTAGCA
TGCACAAAACACATACAAAACACACATCCAAACACAGCTATACTATATTTCTCCGTTCAC
TTACTCTCATGGGAAGATAGCGAGCAGGAGACACGTTCGAGATTTATGATGTTTCTCTCT
AAGAGTCTTCCCATATAGACCAAGAACTCCTCCTCATCATAGCCATGGACAGGGCTTAGC
TCTATCTTCCATGTGACCAAAGCATGCCCATTGTTGCAAGGATCCGACAACGAGAAAGAC
GCGGTGTAGTTCTTAAAACCCAAATTACTGTCCAAAATGGAGTAAGAGAACTCTCTTAAA
CGAGGGTCCCATTCCA
■■Homology search results ■■ -
sp_hit_id Q5LJP9
Definition sp|Q5LJP9|ASND1_DROME Asparagine synthetase domain-containing protein CG17486 OS=Drosophila melanogaster
Align length 129
Score (bit) 30.0
E-value 6.0
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919298|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_D12.
(496 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5LJP9|ASND1_DROME Asparagine synthetase domain-containing pr... 30 6.0
sp|Q9ULG1|INO80_HUMAN Putative DNA helicase INO80 complex homolo... 30 6.1

>sp|Q5LJP9|ASND1_DROME Asparagine synthetase domain-containing
protein CG17486 OS=Drosophila melanogaster GN=CG17486
PE=1 SV=2
Length = 564

Score = 30.0 bits (66), Expect = 6.0
Identities = 31/129 (24%), Positives = 50/129 (38%), Gaps = 5/129 (3%)
Frame = -3

Query: 491 WDPRLREFSYSIL---DSNLGFKNYTASFSLSDPCNNGHALVTWKIELSPVHGYDEEEFL 321
W P L +S +L D +G+K S D W + +P Y+ EF
Sbjct: 190 WQP-LNNYSTQLLRNLDLAIGWKTAVESPMSPD----------WMLNCNPAFSYNFYEFQ 238

Query: 320 VYMGRL-LERNIINLERVSCSLSSHESK*TEKYSIAVFGCV-FCMCFVHASPCLHSLLRS 147
+ L +N+I+ + +LS + ++ V FC C+ L S
Sbjct: 239 YIKNNVNLYKNLIDQSEIKYTLSILHTLLSDSIKNRVRNMAPFCRL------CMQKLNIS 292

Query: 146 PPCARARMC 120
PPC A++C
Sbjct: 293 PPCRHAKLC 301


>sp|Q9ULG1|INO80_HUMAN Putative DNA helicase INO80 complex homolog 1
OS=Homo sapiens GN=INO80 PE=1 SV=2
Length = 1556

Score = 30.0 bits (66), Expect = 6.1
Identities = 13/27 (48%), Positives = 16/27 (59%)
Frame = +2

Query: 203 HIQTQLYYISPFTYSHGKIASRRHVRD 283
HI + Y+IS F Y HG+I H RD
Sbjct: 832 HISLKPYHISKFIYRHGQIRVFNHSRD 858


tr_hit_id A5BHR2
Definition tr|A5BHR2|A5BHR2_VITVI Putative uncharacterized protein (Chromosome chr4 scaffold_6, whole genome shotgun sequence) OS=Vitis vinifera
Align length 64
Score (bit) 48.9
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919298|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_D12.
(496 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BHR2|A5BHR2_VITVI Putative uncharacterized protein (Chromos... 49 1e-04
tr|A7P554|A7P554_VITVI Chromosome chr4 scaffold_6, whole genome ... 47 5e-04
tr|A5BHR3|A5BHR3_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|A9PJ81|A9PJ81_POPJC Putative uncharacterized protein OS=Popul... 46 8e-04
tr|Q5JM62|Q5JM62_ORYSJ Putative uncharacterized protein P0042A10... 44 0.003
tr|A7PEI3|A7PEI3_VITVI Chromosome chr11 scaffold_13, whole genom... 43 0.009
tr|A2WUM6|A2WUM6_ORYSI Putative uncharacterized protein OS=Oryza... 41 0.035
tr|B6UBY7|B6UBY7_MAIZE Lachrymatory-factor synthase OS=Zea mays ... 39 0.13
tr|A2SEB2|A2SEB2_METPP Putative uncharacterized protein OS=Methy... 38 0.30
tr|Q8WYX9|Q8WYX9_HUMAN Putative uncharacterized protein pp10122 ... 35 1.5
tr|Q23LP9|Q23LP9_TETTH Myb-like DNA-binding domain, SHAQKYF clas... 35 2.5
tr|A0RGH8|A0RGH8_BACAH Putative uncharacterized protein OS=Bacil... 34 3.3
tr|B3ZIE1|B3ZIE1_BACCE Putative uncharacterized protein OS=Bacil... 34 3.3
tr|O82320|O82320_ARATH Putative uncharacterized protein At2g2577... 34 3.3
tr|Q8H937|Q8H937_ALLPO Lachrymatory factor synthase OS=Allium am... 34 4.3
tr|Q0Q041|Q0Q041_ANTMY Attacin-like protein OS=Antheraea mylitta... 34 4.4
tr|B0ALQ4|B0ALQ4_BACAN Putative uncharacterized protein OS=Bacil... 33 5.6
tr|B6TSX0|B6TSX0_MAIZE Putative uncharacterized protein OS=Zea m... 33 5.6
tr|Q81MV7|Q81MV7_BACAN Putative uncharacterized protein OS=Bacil... 33 7.3
tr|Q81AY6|Q81AY6_BACCR XoxI OS=Bacillus cereus (strain ATCC 1457... 33 7.3
tr|Q6HG14|Q6HG14_BACHK Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B7JG92|B7JG92_BACCE Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B7H6E4|B7H6E4_BACCE Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B3Z4S8|B3Z4S8_BACCE Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B3YXQ4|B3YXQ4_BACCE Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B3IZI2|B3IZI2_BACAN Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B1UL17|B1UL17_BACAN Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B1GCR2|B1GCR2_BACAN Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B1EUZ1|B1EUZ1_BACAN Putative uncharacterized protein OS=Bacil... 33 7.3
tr|B0QDB3|B0QDB3_BACAN Putative uncharacterized protein OS=Bacil... 33 7.3

>tr|A5BHR2|A5BHR2_VITVI Putative uncharacterized protein (Chromosome
chr4 scaffold_6, whole genome shotgun sequence) OS=Vitis
vinifera GN=GSVIVT00032406001 PE=4 SV=1
Length = 163

Score = 48.9 bits (115), Expect = 1e-04
Identities = 23/64 (35%), Positives = 34/64 (53%)
Frame = -3

Query: 488 DPRLREFSYSILDSNLGFKNYTASFSLSDPCNNGHALVTWKIELSPVHGYDEEEFLVYMG 309
DP FSY +LD+N+GF +Y +F + P N G L+ W PV G+ E+ Y+
Sbjct: 87 DPINHCFSYEVLDNNMGFNSYVTTFKVI-PINGGGCLIQWSFVCDPVQGWRYEDLASYID 145

Query: 308 RLLE 297
L+
Sbjct: 146 SSLQ 149


>tr|A7P554|A7P554_VITVI Chromosome chr4 scaffold_6, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00032405001
PE=4 SV=1
Length = 161

Score = 47.0 bits (110), Expect = 5e-04
Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 7/82 (8%)
Frame = -3

Query: 488 DPRLREFSYSILDSNLGFKNYTASFSLSDPCNNGHALVTWKIELSPVHGYDEEEF----- 324
DP R FSY +LD+N+GF +Y A+ + P + G + W P+ G+ ++
Sbjct: 80 DPIQRCFSYEVLDNNIGFNSYVATIKVL-PVDGGGCRIEWSFASGPIEGWRSDDLGSFVD 138

Query: 323 --LVYMGRLLERNIINLERVSC 264
L +M + +E I N + SC
Sbjct: 139 SCLQFMAKKMEAAIKNEDGSSC 160


>tr|A5BHR3|A5BHR3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_034796 PE=4 SV=1
Length = 172

Score = 47.0 bits (110), Expect = 5e-04
Identities = 25/82 (30%), Positives = 41/82 (50%), Gaps = 7/82 (8%)
Frame = -3

Query: 488 DPRLREFSYSILDSNLGFKNYTASFSLSDPCNNGHALVTWKIELSPVHGYDEEEF----- 324
DP R FSY +LD+N+GF +Y A+ + P + G + W P+ G+ ++
Sbjct: 91 DPIQRCFSYEVLDNNIGFNSYVATIKVL-PVDGGGCRIEWSFASGPIEGWRSDDLGSFVD 149

Query: 323 --LVYMGRLLERNIINLERVSC 264
L +M + +E I N + SC
Sbjct: 150 SCLQFMAKKMEAAIKNEDGSSC 171


>tr|A9PJ81|A9PJ81_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 171

Score = 46.2 bits (108), Expect = 8e-04
Identities = 26/82 (31%), Positives = 44/82 (53%), Gaps = 13/82 (15%)
Frame = -3

Query: 488 DPRLREFSYSILDSNLGFKNYTASFSLSDPCNNGHA------LVTWKIELSPVHGYDEEE 327
+P R SY IL++N GFK+Y A+ +S P N+G + W P+ G+ E+
Sbjct: 90 NPSERCLSYEILENNAGFKSYVATMKVS-PINDGDGDGHHGCTIEWSFIADPIEGWPLED 148

Query: 326 F-------LVYMGRLLERNIIN 282
F L +MG+ +ER++++
Sbjct: 149 FNSYINSSLQFMGKKMERDVLS 170


>tr|Q5JM62|Q5JM62_ORYSJ Putative uncharacterized protein P0042A10.2
(Putative uncharacterized protein) (Putative
uncharacterized protein P0022F10.27) OS=Oryza sativa
subsp. japonica GN=P0042A10.2 PE=4 SV=1
Length = 222

Score = 44.3 bits (103), Expect = 0.003
Identities = 22/65 (33%), Positives = 34/65 (52%), Gaps = 1/65 (1%)
Frame = -3

Query: 494 EWDPRLREFSYSILDSNLGFKNYTASFSLS-DPCNNGHALVTWKIELSPVHGYDEEEFLV 318
E+DP R +SY ++++N GF Y A+ + DP V W E PV G+ E F+
Sbjct: 145 EFDPVARRYSYEVVETNKGFGRYAATLRVEPDPAG---CAVAWSFEADPVRGWSLEGFVG 201

Query: 317 YMGRL 303
++ L
Sbjct: 202 FLDEL 206


>tr|A7PEI3|A7PEI3_VITVI Chromosome chr11 scaffold_13, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00016676001
PE=4 SV=1
Length = 209

Score = 42.7 bits (99), Expect = 0.009
Identities = 35/136 (25%), Positives = 63/136 (46%), Gaps = 6/136 (4%)
Frame = -3

Query: 488 DPRLREFSYSILDSNLGFKNYTASFSLSDPCNNGHALVTWKIELSPVHGYDEEEFLVYMG 309
DP FSYSI+D N+GF +Y ++ + P G + W+ E+ PV G+ + ++G
Sbjct: 93 DPDELTFSYSIIDGNVGFNSYVSTVKVL-PTEEG-CSIEWRYEVEPVEGWTLGDLDSFIG 150

Query: 308 RLLERNIINLERVSCSLSSHESK*TEKYSIA------VFGCVFCMCFVHASPCLHSLLRS 147
L+ + +R+ +L + ++ K+S++ +F C + +H L+
Sbjct: 151 SGLQ---VMAKRMEAALKAGMNR-ISKFSLSFSPTRDIFSCFYSYTSLH-------LILF 199

Query: 146 PPCARARMCECVC*SG 99
P C C C SG
Sbjct: 200 P-------CYCRCSSG 208


>tr|A2WUM6|A2WUM6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03580 PE=4 SV=1
Length = 164

Score = 40.8 bits (94), Expect = 0.035
Identities = 21/65 (32%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
Frame = -3

Query: 494 EWDPRLREFSYSILDSNLGFKNYTASFSLS-DPCNNGHALVTWKIELSPVHGYDEEEFLV 318
E+DP R +SY ++++N GF Y A+ + DP V W E V G+ E F+
Sbjct: 87 EFDPVARRYSYEVVETNKGFGRYAATLRVEPDPAG---CAVAWSFEADQVRGWTLEGFVG 143

Query: 317 YMGRL 303
++ L
Sbjct: 144 FLDEL 148


>tr|B6UBY7|B6UBY7_MAIZE Lachrymatory-factor synthase OS=Zea mays
PE=2 SV=1
Length = 177

Score = 38.9 bits (89), Expect = 0.13
Identities = 23/65 (35%), Positives = 33/65 (50%), Gaps = 1/65 (1%)
Frame = -3

Query: 494 EWDPRLREFSYSILDSNLGFKNYTASFSLS-DPCNNGHALVTWKIELSPVHGYDEEEFLV 318
E D R +SY +L+SN GF Y A+ + DP V W E PV G+ + FL
Sbjct: 100 EMDHAGRWYSYELLESNKGFGRYRATVRVEHDPAG---CAVRWSFEADPVKGWTLDGFLG 156

Query: 317 YMGRL 303
++ +L
Sbjct: 157 FLEKL 161


>tr|A2SEB2|A2SEB2_METPP Putative uncharacterized protein
OS=Methylibium petroleiphilum (strain PM1) GN=Mpe_A0939
PE=4 SV=1
Length = 166

Score = 37.7 bits (86), Expect = 0.30
Identities = 20/66 (30%), Positives = 34/66 (51%)
Frame = -3

Query: 476 REFSYSILDSNLGFKNYTASFSLSDPCNNGHALVTWKIELSPVHGYDEEEFLVYMGRLLE 297
R +SY+I++S L NY A+ +L+ P G +TW+ HG +E+ +G L +
Sbjct: 96 RSYSYAIVESALPVANYKATITLT-PAEEGRTRMTWRSTFD-AHGVSDEQATTIIGALQD 153

Query: 296 RNIINL 279
+ L
Sbjct: 154 AGMAKL 159


>tr|Q8WYX9|Q8WYX9_HUMAN Putative uncharacterized protein pp10122
OS=Homo sapiens GN=pp10122 PE=2 SV=1
Length = 400

Score = 35.4 bits (80), Expect = 1.5
Identities = 16/36 (44%), Positives = 20/36 (55%)
Frame = -3

Query: 206 CVFCMCFVHASPCLHSLLRSPPCARARMCECVC*SG 99
C FCMC V+ C+H + + CA MC CVC G
Sbjct: 24 CAFCMC-VYVCVCVHVHVCASVCAFVCMCVCVCVCG 58