BP919331
Clone id YMU001_000123_H02
Library
Length 507
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000123_H02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GACATCTCACATCATCTGCTGATGTGCGGCCACCATACATCATTGCCAACCACTCACAAT
TTTCCTCGAAGCTAGGCTGCCTTGCAGTATCCATTAACCAATACGTCACCAAATCGCTAG
AACAATCTTGTAGCTAGGGGGTCAATCTGTCTAGACCCTTCTGAAGAACTTTCATTACAA
GATCCTCGACCTTCCCGGCCTCTAAATGATTCTCTTCACCGATATTCCCTGCAATATCCC
AACCCACCTGCAACTTCGAAATAATACTCTCCAGATCTCCATCATTCAACCACTCTCTTC
CTTGTTCTCAGAGCTCGACTCCCCTCACCTTCACAAACAGAGGATAGAAATGTTCCCCAA
TAAAACAGGAACGTGCAAGCCTGGTGAGTAGATGTTGGGGAGGTAGCATATGAGAGCTCA
AACAACTGTAAGAGATGAACGCCTCCACTACATCGTCCTCGTTCATGCTGGGAACATGCA
CTATGTCTAAAGCATGGCTATTTGGAA
■■Homology search results ■■ -
sp_hit_id O74346
Definition sp|O74346|MAP4_SCHPO P cell-type agglutination protein map4 OS=Schizosaccharomyces pombe
Align length 53
Score (bit) 32.3
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919331|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_H02.
(507 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O74346|MAP4_SCHPO P cell-type agglutination protein map4 OS=S... 32 1.3
sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron tra... 32 2.2
sp|Q9C103|EME1_SCHPO Crossover junction endonuclease eme1 OS=Sch... 32 2.2
sp|Q992J0|RDRP_BOOLV RNA-directed RNA polymerase OS=Boolarra vir... 31 2.9
sp|P73423|CBID_SYNY3 Putative cobalt-precorrin-6A synthase [deac... 30 4.9
sp|P22570|ADRO_HUMAN NADPH:adrenodoxin oxidoreductase, mitochond... 30 8.6

>sp|O74346|MAP4_SCHPO P cell-type agglutination protein map4
OS=Schizosaccharomyces pombe GN=map4 PE=2 SV=1
Length = 948

Score = 32.3 bits (72), Expect = 1.3
Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%)
Frame = +3

Query: 183 SSTFPASK*FSSPIFPAISQPT-CNFEIILSRSPSFNHSLPCSQSSTPLTFTN 338
S+T P S + P++S T +F II + + S+ HS P SS PLT N
Sbjct: 417 STTLPTSSKMITTTTPSVSNNTQSSFLIISTFTSSYEHSEPFKVSSVPLTSNN 469


>sp|P42433|NASB_BACSU Assimilatory nitrate reductase electron
transfer subunit OS=Bacillus subtilis GN=nasB PE=2 SV=1
Length = 770

Score = 31.6 bits (70), Expect = 2.2
Identities = 12/25 (48%), Positives = 18/25 (72%)
Frame = -3

Query: 79 QPSFEENCEWLAMMYGGRTSADDVR 5
+P+ EE C + MYGGRT+A+ +R
Sbjct: 536 EPATEETCILIPQMYGGRTNAEQLR 560


>sp|Q9C103|EME1_SCHPO Crossover junction endonuclease eme1
OS=Schizosaccharomyces pombe GN=eme1 PE=1 SV=1
Length = 738

Score = 31.6 bits (70), Expect = 2.2
Identities = 24/77 (31%), Positives = 36/77 (46%), Gaps = 4/77 (5%)
Frame = +3

Query: 156 PF*RTFITRSSTF----PASK*FSSPIFPAISQPTCNFEIILSRSPSFNHSLPCSQSSTP 323
PF ++ +T++ +F +S P P+I+ PT N LS +PS + P SS
Sbjct: 216 PFTQSPLTKTKSFNDALTSSSSILKPCMPSIASPTSNR---LSHAPSTPNLFPNQDSSNT 272

Query: 324 LTFTNRG*KCSPIKQER 374
+ N K S QER
Sbjct: 273 IDLINNRSKTSVENQER 289


>sp|Q992J0|RDRP_BOOLV RNA-directed RNA polymerase OS=Boolarra virus
PE=3 SV=1
Length = 998

Score = 31.2 bits (69), Expect = 2.9
Identities = 15/43 (34%), Positives = 21/43 (48%)
Frame = -3

Query: 133 LQDCSSDLVTYWLMDTARQPSFEENCEWLAMMYGGRTSADDVR 5
+ D + D V +L A P E C + +YG +TS DVR
Sbjct: 764 IADAACDRVEGYLCTDAHTPLISEYCRMVQRLYGPKTSTRDVR 806


>sp|P73423|CBID_SYNY3 Putative cobalt-precorrin-6A synthase
[deacetylating] OS=Synechocystis sp. (strain PCC 6803)
GN=cbiD PE=3 SV=2
Length = 378

Score = 30.4 bits (67), Expect = 4.9
Identities = 22/78 (28%), Positives = 35/78 (44%), Gaps = 1/78 (1%)
Frame = -3

Query: 235 IAGNIGE-ENHLEAGKVEDLVMKVLQKGLDRLTP*LQDCSSDLVTYWLMDTARQPSFEEN 59
+AG I +HL G++E L + +Q GL P +Q+ T + R E+N
Sbjct: 256 LAGGIFHTHHHLADGRLEILTAQAVQAGLPY--PLVQELGQAPTTEAGLKLLRHWQTEQN 313

Query: 58 CEWLAMMYGGRTSADDVR 5
C W++ +Y D R
Sbjct: 314 CPWVSKIYQAMADTVDRR 331


>sp|P22570|ADRO_HUMAN NADPH:adrenodoxin oxidoreductase,
mitochondrial OS=Homo sapiens GN=FDXR PE=1 SV=3
Length = 491

Score = 29.6 bits (65), Expect = 8.6
Identities = 21/65 (32%), Positives = 29/65 (44%), Gaps = 5/65 (7%)
Frame = +1

Query: 151 LDPSEELSLQD-----PRPSRPLNDSLHRYSLQYPNPPATSK*YSPDLHHSTTLFLVLRA 315
LDP + L LQD PRP + L + L R + + P P ++ S F +
Sbjct: 254 LDPVDFLGLQDKIKEVPRPRKRLTELLLRTATEKPGPAEAARQASASRAWGLRFFRSPQQ 313

Query: 316 RLPSP 330
LPSP
Sbjct: 314 VLPSP 318


tr_hit_id Q5KLY8
Definition tr|Q5KLY8|Q5KLY8_CRYNE Expressed protein OS=Cryptococcus neoformans
Align length 127
Score (bit) 39.3
E-value 0.11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919331|Adiantum capillus-veneris mRNA, clone:
YMU001_000123_H02.
(507 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q5KLY8|Q5KLY8_CRYNE Expressed protein OS=Cryptococcus neoform... 39 0.11
tr|Q55Y02|Q55Y02_CRYNE Putative uncharacterized protein OS=Crypt... 39 0.11
tr|A9V3I7|A9V3I7_MONBE Predicted protein OS=Monosiga brevicollis... 34 3.5
tr|A9JTP9|A9JTP9_XENTR LOC100127817 protein OS=Xenopus tropicali... 34 4.7
tr|B5UXF4|B5UXF4_BACCE Thymidylate synthase OS=Bacillus cereus A... 33 6.0
tr|Q86AE8|Q86AE8_DICDI Similar to Cryptosporidium parvum. Type I... 33 7.8
tr|B0G0Z9|B0G0Z9_DICDI Putative polyketide synthase OS=Dictyoste... 33 7.8

>tr|Q5KLY8|Q5KLY8_CRYNE Expressed protein OS=Cryptococcus neoformans
GN=CNB03580 PE=4 SV=1
Length = 309

Score = 39.3 bits (90), Expect = 0.11
Identities = 38/127 (29%), Positives = 54/127 (42%), Gaps = 19/127 (14%)
Frame = +1

Query: 175 LQDPRPSRPLNDSLHRYSLQYPNPPATSK*YSPDLHHSTTLFLVLRARLPSPSQ--TEDR 348
++ P P RP SLH + + PP ++ SP LHHS++ FL PS TE
Sbjct: 28 MRPPAPPRPEPPSLHSWLHPHAPPPTLAR--SPPLHHSSSTFLTFAVSFLPPSHVTTEAA 85

Query: 349 NVPQ*NRNVQAW*V---------DVGEVAYESSN--------NCKR*TPPLHRPRSCWEH 477
+ R V+ V GE A+++ + +R P HR +C
Sbjct: 86 LAKEAKRIVRELDVVRRAGPELMAAGEGAFQAGDGRAPGRAPGNERAREPDHRMWAC--R 143

Query: 478 ALCLKHG 498
ALCLK G
Sbjct: 144 ALCLKEG 150


>tr|Q55Y02|Q55Y02_CRYNE Putative uncharacterized protein
OS=Cryptococcus neoformans GN=CNBB2120 PE=4 SV=1
Length = 255

Score = 39.3 bits (90), Expect = 0.11
Identities = 38/127 (29%), Positives = 54/127 (42%), Gaps = 19/127 (14%)
Frame = +1

Query: 175 LQDPRPSRPLNDSLHRYSLQYPNPPATSK*YSPDLHHSTTLFLVLRARLPSPSQ--TEDR 348
++ P P RP SLH + + PP ++ SP LHHS++ FL PS TE
Sbjct: 1 MRPPAPPRPEPPSLHSWLHPHAPPPTLAR--SPPLHHSSSTFLTFAVSFLPPSHVTTEAA 58

Query: 349 NVPQ*NRNVQAW*V---------DVGEVAYESSN--------NCKR*TPPLHRPRSCWEH 477
+ R V+ V GE A+++ + +R P HR +C
Sbjct: 59 LAKEAKRIVRELDVVRRAGPELMAAGEGAFQAGDGRAPGRAPGNERAREPDHRMWAC--R 116

Query: 478 ALCLKHG 498
ALCLK G
Sbjct: 117 ALCLKEG 123


>tr|A9V3I7|A9V3I7_MONBE Predicted protein OS=Monosiga brevicollis
GN=9704 PE=4 SV=1
Length = 376

Score = 34.3 bits (77), Expect = 3.5
Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 3/117 (2%)
Frame = -3

Query: 400 PQHLLT---RLARSCFIGEHFYPLFVKVRGVEL*EQGREWLNDGDLESIISKLQVGWDIA 230
P HL+ R +S F ++ +FVK G L Q EW+NDG ++ +I K + W
Sbjct: 271 PSHLVALSFRKFKSLFANYKYHTVFVKPNGDAL-RQITEWINDGRIKPLIDK-EFSWKEV 328

Query: 229 GNIGEENHLEAGKVEDLVMKVLQKGLDRLTP*LQDCSSDLVTYWLMDTARQPSFEEN 59
++L G V K++ +D ++D + L +Y L D Q S +N
Sbjct: 329 DQ--AHDYLAKGHVHG---KLIINHVDD----VEDTLNGLQSYSLADRELQDSGNQN 376


>tr|A9JTP9|A9JTP9_XENTR LOC100127817 protein OS=Xenopus tropicalis
GN=LOC100127817 PE=2 SV=1
Length = 346

Score = 33.9 bits (76), Expect = 4.7
Identities = 34/99 (34%), Positives = 45/99 (45%), Gaps = 1/99 (1%)
Frame = +1

Query: 16 LLMCGHHTSLPTTHNFPRS*AALQYPLTNTSPNR*NNLVARGSICLDPSEELSLQDPRPS 195
+L C +TS P TH +S A Q P + + P+ N+ I P LSL P S
Sbjct: 215 VLWCYSNTSKPHTH---KSLHASQKPTSLSLPH--NSTPTSPFI---PGGFLSLSTPPIS 266

Query: 196 RPLNDSLHRYSLQ-YPNPPATSK*YSPDLHHSTTLFLVL 309
PL D +HRY + + P +K S LH T VL
Sbjct: 267 VPLGDGMHRYDIDLFGTDPVAAK--SHILHQVTEALRVL 303


>tr|B5UXF4|B5UXF4_BACCE Thymidylate synthase OS=Bacillus cereus
AH1134 GN=thyA_2 PE=4 SV=1
Length = 326

Score = 33.5 bits (75), Expect = 6.0
Identities = 14/29 (48%), Positives = 20/29 (68%)
Frame = +2

Query: 221 DIPCNIPTHLQLRNNTLQISIIQPLSSLF 307
DIPCNI L++RNN L +++I + LF
Sbjct: 149 DIPCNISIMLKIRNNLLDMTVINRSNDLF 177


>tr|Q86AE8|Q86AE8_DICDI Similar to Cryptosporidium parvum. Type I
fatty acid synthase OS=Dictyostelium discoideum PE=4 SV=1
Length = 2700

Score = 33.1 bits (74), Expect = 7.8
Identities = 18/48 (37%), Positives = 28/48 (58%)
Frame = +2

Query: 221 DIPCNIPTHLQLRNNTLQISIIQPLSSLFSELDSPHLHKQRIEMFPNK 364
+I N+ T QL+NNT+ ISI L+SL + +L RI+ + N+
Sbjct: 2257 EIGINLITIQQLQNNTINISIKMILNSLMKNNQNKYLPSNRIDYWKNE 2304


>tr|B0G0Z9|B0G0Z9_DICDI Putative polyketide synthase OS=Dictyostelium
discoideum GN=pks6 PE=4 SV=1
Length = 2924

Score = 33.1 bits (74), Expect = 7.8
Identities = 18/48 (37%), Positives = 28/48 (58%)
Frame = +2

Query: 221 DIPCNIPTHLQLRNNTLQISIIQPLSSLFSELDSPHLHKQRIEMFPNK 364
+I N+ T QL+NNT+ ISI L+SL + +L RI+ + N+
Sbjct: 2481 EIGINLITIQQLQNNTINISIKMILNSLMKNNQNKYLPSNRIDYWKNE 2528