BP919341
Clone id YMU001_000124_A01
Library
Length 433
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000124_A01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCGGAGTGCTGAACCTTCCAATGCCAAGCTCAGAAAAACCTTCTGCTCTTTGGAAATGCG
CGCGTGCGCGAAACCGAAAAACGGCAATGAAACAGCAGCAAGTTTCAACACACTCAACAA
TGATGATGAAGCTCTCAATGCTCTCACTACCAAGCTCTGATACCACTTGTTGGGATCGAA
GAGCACACACACAGAGAGCCAACACGAAGAAGGAGATAGACACAGTGTATGGCGGGGCGG
TACTCACACTACAATGTGTAGTTATGAGTATAGTTATTATGAATGAGTAAATGAATGGCT
GTACATGGGCGGCTGAACAACGGGCAGCCGGGCACACGGGCCTTTAACCCAACACTCAAC
ACGTATTGGGTCAACAACCTTCGTAACTAGGACATAATGCAGTGCTTGTAAAGTACATGC
ACCCAAAGGGAGT
■■Homology search results ■■ -
sp_hit_id P35575
Definition sp|P35575|G6PC_HUMAN Glucose-6-phosphatase OS=Homo sapiens
Align length 40
Score (bit) 31.2
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919341|Adiantum capillus-veneris mRNA, clone:
YMU001_000124_A01.
(433 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P35575|G6PC_HUMAN Glucose-6-phosphatase OS=Homo sapiens GN=G6... 31 1.9
sp|P35576|G6PC_MOUSE Glucose-6-phosphatase OS=Mus musculus GN=G6... 31 2.5
sp|Q19KA1|G6PC_FELCA Glucose-6-phosphatase OS=Felis silvestris c... 31 2.5
sp|Q29RU6|G6PC_BOVIN Glucose-6-phosphatase OS=Bos taurus GN=G6PC... 30 3.3

>sp|P35575|G6PC_HUMAN Glucose-6-phosphatase OS=Homo sapiens GN=G6PC
PE=1 SV=2
Length = 357

Score = 31.2 bits (69), Expect = 1.9
Identities = 15/40 (37%), Positives = 21/40 (52%)
Frame = -1

Query: 298 PFIYSFIITILITTHCSVSTAPPYTVSISFFVLALCVCAL 179
PF S I+ L+ H S PP V + F+VL+ C A+
Sbjct: 293 PFRLSSIVASLVLLHVFDSLKPPSQVELVFYVLSFCKSAV 332


>sp|P35576|G6PC_MOUSE Glucose-6-phosphatase OS=Mus musculus GN=G6pc
PE=2 SV=1
Length = 357

Score = 30.8 bits (68), Expect = 2.5
Identities = 13/39 (33%), Positives = 21/39 (53%)
Frame = -1

Query: 298 PFIYSFIITILITTHCSVSTAPPYTVSISFFVLALCVCA 182
PF ++ I+ L+ H S PP V + F++L+ C A
Sbjct: 293 PFRFACIVASLVLLHLFDSLKPPSQVELIFYILSFCKSA 331


>sp|Q19KA1|G6PC_FELCA Glucose-6-phosphatase OS=Felis silvestris
catus GN=G6PC PE=2 SV=1
Length = 357

Score = 30.8 bits (68), Expect = 2.5
Identities = 15/39 (38%), Positives = 20/39 (51%)
Frame = -1

Query: 298 PFIYSFIITILITTHCSVSTAPPYTVSISFFVLALCVCA 182
PF S I+ LI H S PP + + F+VL+ C A
Sbjct: 293 PFRLSCIVVSLILLHLFDSLKPPSQIELIFYVLSFCKSA 331


>sp|Q29RU6|G6PC_BOVIN Glucose-6-phosphatase OS=Bos taurus GN=G6PC
PE=2 SV=1
Length = 357

Score = 30.4 bits (67), Expect = 3.3
Identities = 14/39 (35%), Positives = 20/39 (51%)
Frame = -1

Query: 298 PFIYSFIITILITTHCSVSTAPPYTVSISFFVLALCVCA 182
PF S I+ L+ H S PP + + F+VL+ C A
Sbjct: 293 PFRLSCIVASLVLLHLFDSLKPPSQIELIFYVLSFCKSA 331


tr_hit_id B4MLH7
Definition tr|B4MLH7|B4MLH7_DROWI GK17218 OS=Drosophila willistoni
Align length 51
Score (bit) 34.7
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919341|Adiantum capillus-veneris mRNA, clone:
YMU001_000124_A01.
(433 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4MLH7|B4MLH7_DROWI GK17218 OS=Drosophila willistoni GN=GK172... 35 2.4
tr|Q9XUQ7|Q9XUQ7_CAEEL Protein T08G5.1, partially confirmed by t... 34 4.2

>tr|B4MLH7|B4MLH7_DROWI GK17218 OS=Drosophila willistoni GN=GK17218
PE=4 SV=1
Length = 1043

Score = 34.7 bits (78), Expect = 2.4
Identities = 16/51 (31%), Positives = 32/51 (62%), Gaps = 2/51 (3%)
Frame = +2

Query: 65 CAKPKNGNETAASFNTLNNDDEA--LNALTTKL*YHLLGSKSTHTESQHEE 211
C+ KNGN+TA++ N NN+ + L TT++ Y+ + S +T ++++ +
Sbjct: 418 CSSLKNGNKTASTTNNNNNNSSSNQLEQQTTQIVYNFMYSNNTRQQTEYTQ 468


>tr|Q9XUQ7|Q9XUQ7_CAEEL Protein T08G5.1, partially confirmed by
transcript evidence OS=Caenorhabditis elegans GN=T08G5.1
PE=4 SV=2
Length = 241

Score = 33.9 bits (76), Expect = 4.2
Identities = 13/30 (43%), Positives = 17/30 (56%)
Frame = +2

Query: 170 LGSKSTHTESQHEEGDRHSVWRGGTHTTMC 259
+G KS+ T +H E DRHS W T+C
Sbjct: 1 MGQKSSRTAPEHVEEDRHSAWGSDIDETLC 30