BP919369
Clone id YMU001_000124_C11
Library
Length 535
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000124_C11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTGTCGATTTGTGTCTTGTCAAGAGCTCCCGAAAAGTGGCGGCAGCATCAGACTGAACTT
CGAAATTAGGTATTTCCAGGTAGCCAAAAAACTTTCTCAAGTTTTCAGACTCTAAAACGT
ACCTTGCTGCTACTTGATGTCTTATGCACTCTCGAAGCATCGTACCATAGTGCAATGCCA
TGTCTGTGTTGTCGTAGCCTGCAACAAGAATATCCAGTAAATCTTTATTGGAGTCTAAAT
AGTCACTTGCAATCAAGCGGGAATGGACCTGCTGACGTTGTAAGTTTGCAATAACCTGTG
TAGTGTCCTTTCGTGTCTCCAAATCAAGCTTAGAAAGCAGCACAATGAGGAGCCTCATTA
TATTTTCTCGGCAAGAATTCCTGAGTCAATTGAGTACAAGCTTCTGGAACAGGTTCAGAT
TCTGAGTTCCCATACAAGATAACCTTCATCTCTCTTATATTCTTCCCTAAGTCGGCCATC
TTCTCTTCTTTCTTTCCATCACGGGATGCAGTTGGCATATCTATATATGCAAGAA
■■Homology search results ■■ -
sp_hit_id Q9FGK3
Definition sp|Q9FGK3|MO25N_ARATH Putative MO25-like protein At5g47540 OS=Arabidopsis thaliana
Align length 123
Score (bit) 187.0
E-value 3.0e-62
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919369|Adiantum capillus-veneris mRNA, clone:
YMU001_000124_C11.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9FGK3|MO25N_ARATH Putative MO25-like protein At5g47540 OS=Ar... 187 3e-62
sp|Q9M0M4|MO25M_ARATH Putative MO25-like protein At4g17270 OS=Ar... 177 1e-58
sp|Q9ZQ77|MO25L_ARATH MO25-like protein At2g03410 OS=Arabidopsis... 153 7e-48
sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens... 103 2e-28
sp|Q29RI6|CAB39_BOVIN Calcium-binding protein 39 OS=Bos taurus G... 103 2e-28
sp|Q06138|CAB39_MOUSE Calcium-binding protein 39 OS=Mus musculus... 103 3e-28
sp|P91891|MO25_DROME Protein Mo25 OS=Drosophila melanogaster GN=... 100 6e-25
sp|O18211|MO25M_CAEEL Uncharacterized MO25-like protein Y53C12A.... 97 2e-23
sp|Q9DB16|CB39L_MOUSE Calcium-binding protein 39-like OS=Mus mus... 105 1e-22
sp|Q9H9S4|CB39L_HUMAN Calcium-binding protein 39-like OS=Homo sa... 103 4e-22
sp|Q9XFY6|DEE76_CHLPR Degreening-related gene dee76 protein OS=C... 96 8e-20
sp|Q9P7Q8|PMO25_SCHPO Mo25-like protein OS=Schizosaccharomyces p... 86 1e-16
sp|O60032|HYMA_EMENI Conidiophore development protein hymA OS=Em... 64 5e-10
sp|P32464|HYM1_YEAST Protein HYM1 OS=Saccharomyces cerevisiae GN... 47 4e-05
sp|P53170|YGF9_YEAST Probable protein kinase YGL059W OS=Saccharo... 35 0.18
sp|Q1QX86|NQRA_CHRSD Na(+)-translocating NADH-quinone reductase ... 31 3.3
sp|Q5ZKK3|APC5_CHICK Anaphase-promoting complex subunit 5 OS=Gal... 30 7.4
sp|P19712|POLG_CSFVA Genome polyprotein OS=Classical swine fever... 30 9.5
sp|Q01499|POLG_BVDVS Genome polyprotein OS=Bovine viral diarrhea... 30 9.5
sp|P19711|POLG_BVDVN Genome polyprotein OS=Bovine viral diarrhea... 30 9.5
sp|Q96662|POLG_BVDVC Genome polyprotein OS=Bovine viral diarrhea... 30 9.5
sp|Q29480|P53_EQUAS Cellular tumor antigen p53 (Fragment) OS=Equ... 30 9.5

>sp|Q9FGK3|MO25N_ARATH Putative MO25-like protein At5g47540
OS=Arabidopsis thaliana GN=At5g47540 PE=2 SV=1
Length = 343

Score = 187 bits (475), Expect(2) = 3e-62
Identities = 85/123 (69%), Positives = 111/123 (90%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
+E+ +RLLI L KL+LETRKD TQV+ANLQRQQV+SRLIASDYL++N DL+D+L+ G++
Sbjct: 80 KEDTLRLLITCLPKLNLETRKDATQVVANLQRQQVNSRLIASDYLEANIDLMDVLIEGFE 139

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTDMALHYG M RECIRHQ+ A+YVLES++++KFF Y+++PNF++ +DAAATF+ELLTRH
Sbjct: 140 NTDMALHYGAMFRECIRHQIVAKYVLESDHVKKFFDYIQLPNFDIAADAAATFKELLTRH 199

Query: 10 KST 2
KST
Sbjct: 200 KST 202



Score = 70.9 bits (172), Expect(2) = 3e-62
Identities = 32/43 (74%), Positives = 38/43 (88%)
Frame = -3

Query: 503 RDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
RD K++EKMA+L +NIR+MK ILYGNSE+EPV EAC QLTQEF
Sbjct: 36 RDSKRDEKMAELSRNIRDMKSILYGNSEAEPVAEACAQLTQEF 78


>sp|Q9M0M4|MO25M_ARATH Putative MO25-like protein At4g17270
OS=Arabidopsis thaliana GN=At4g17270 PE=2 SV=1
Length = 343

Score = 177 bits (450), Expect(2) = 1e-58
Identities = 82/123 (66%), Positives = 107/123 (86%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
+ + +R L+ L L+LE RKD TQV+ANLQRQQV+SRLIA+DYL+SN DL+D LV G++
Sbjct: 80 KADTLRRLLTSLPNLNLEARKDATQVVANLQRQQVNSRLIAADYLESNIDLMDFLVDGFE 139

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTDMALHYGTM RECIRHQ+ A+YVL+SE+++KFF Y+++PNF++ +DAAATF+ELLTRH
Sbjct: 140 NTDMALHYGTMFRECIRHQIVAKYVLDSEHVKKFFYYIQLPNFDIAADAAATFKELLTRH 199

Query: 10 KST 2
KST
Sbjct: 200 KST 202



Score = 68.2 bits (165), Expect(2) = 1e-58
Identities = 30/43 (69%), Positives = 38/43 (88%)
Frame = -3

Query: 503 RDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
R+ K+EEKM +L K+IR++K+ILYGNSE+EPV EAC QLTQEF
Sbjct: 36 RESKREEKMVELSKSIRDLKLILYGNSEAEPVAEACAQLTQEF 78


>sp|Q9ZQ77|MO25L_ARATH MO25-like protein At2g03410 OS=Arabidopsis
thaliana GN=At2g03410 PE=2 SV=1
Length = 348

Score = 153 bits (387), Expect(2) = 7e-48
Identities = 74/124 (59%), Positives = 99/124 (79%), Gaps = 1/124 (0%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
R + +R LI + KLDLE RKD TQ++ANLQ+QQV RL+AS+YL+SN D++D LV G D
Sbjct: 80 RADTLRPLIKSIPKLDLEARKDATQIVANLQKQQVEFRLVASEYLESNLDVIDSLVEGID 139

Query: 190 NT-DMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTR 14
+ ++ALHY ML+EC+RHQV A+Y+LES+NL KFF Y+++P F+V +DA+ FRELLTR
Sbjct: 140 HDHELALHYTGMLKECVRHQVVAKYILESKNLEKFFDYVQLPYFDVATDASKIFRELLTR 199

Query: 13 HKST 2
HKST
Sbjct: 200 HKST 203



Score = 56.6 bits (135), Expect(2) = 7e-48
Identities = 27/46 (58%), Positives = 35/46 (76%)
Frame = -3

Query: 512 TASRDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
T +R+ K+ A+L +NIR++K ILYGN E+EPVPEAC LTQEF
Sbjct: 33 TDARNSKRLGICAELCRNIRDLKSILYGNGEAEPVPEACLLLTQEF 78


>sp|Q9Y376|CAB39_HUMAN Calcium-binding protein 39 OS=Homo sapiens
GN=CAB39 PE=1 SV=1
Length = 341

Score = 103 bits (258), Expect(2) = 2e-28
Identities = 48/118 (40%), Positives = 80/118 (67%)
Frame = -1

Query: 361 IMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNTD 182
++ L+ L +D E +KD Q+ N+ R+Q+ +R +Y+ + +++L +L+ GY++ +
Sbjct: 79 LLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPE 138

Query: 181 MALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRHK 8
+AL+ G MLRECIRH+ A+ +L SE FF Y+E+ F++ SDA ATF++LLTRHK
Sbjct: 139 IALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHK 196



Score = 40.8 bits (94), Expect(2) = 2e-28
Identities = 20/41 (48%), Positives = 25/41 (60%)
Frame = -3

Query: 500 DGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQE 378
D K E+ ++ KN+ MK ILYG +E EP EA QL QE
Sbjct: 33 DKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQE 73


>sp|Q29RI6|CAB39_BOVIN Calcium-binding protein 39 OS=Bos taurus
GN=CAB39 PE=2 SV=1
Length = 341

Score = 103 bits (258), Expect(2) = 2e-28
Identities = 48/118 (40%), Positives = 80/118 (67%)
Frame = -1

Query: 361 IMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNTD 182
++ L+ L +D E +KD Q+ N+ R+Q+ +R +Y+ + +++L +L+ GY++ +
Sbjct: 79 LLSTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPE 138

Query: 181 MALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRHK 8
+AL+ G MLRECIRH+ A+ +L SE FF Y+E+ F++ SDA ATF++LLTRHK
Sbjct: 139 IALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHK 196



Score = 40.8 bits (94), Expect(2) = 2e-28
Identities = 20/41 (48%), Positives = 25/41 (60%)
Frame = -3

Query: 500 DGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQE 378
D K E+ ++ KN+ MK ILYG +E EP EA QL QE
Sbjct: 33 DKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQE 73


>sp|Q06138|CAB39_MOUSE Calcium-binding protein 39 OS=Mus musculus
GN=Cab39 PE=1 SV=1
Length = 341

Score = 103 bits (257), Expect(2) = 3e-28
Identities = 48/118 (40%), Positives = 80/118 (67%)
Frame = -1

Query: 361 IMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNTD 182
++ L+ L +D E +KD Q+ N+ R+Q+ +R +Y+ + +++L +L+ GY++ +
Sbjct: 79 LLGTLVADLQLIDFEGKKDVAQIFNNILRRQIGTRTPTVEYICTQQNILFMLLKGYESPE 138

Query: 181 MALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRHK 8
+AL+ G MLRECIRH+ A+ +L SE FF Y+E+ F++ SDA ATF++LLTRHK
Sbjct: 139 IALNCGIMLRECIRHEPLAKIILWSEQFYDFFRYVEMSTFDIASDAFATFKDLLTRHK 196



Score = 40.8 bits (94), Expect(2) = 3e-28
Identities = 20/41 (48%), Positives = 25/41 (60%)
Frame = -3

Query: 500 DGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQE 378
D K E+ ++ KN+ MK ILYG +E EP EA QL QE
Sbjct: 33 DKKAEKATEEVSKNLVAMKEILYGTNEKEPQTEAVAQLAQE 73


>sp|P91891|MO25_DROME Protein Mo25 OS=Drosophila melanogaster
GN=Mo25 PE=2 SV=2
Length = 339

Score = 99.8 bits (247), Expect(2) = 6e-25
Identities = 49/121 (40%), Positives = 81/121 (66%), Gaps = 2/121 (1%)
Frame = -1

Query: 364 NIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNT 185
N++ LLI L ++D E +K + N+ R+Q+ +R +Y+ + ++L L+AGY++
Sbjct: 75 NLLLLLIQNLHRIDFEGKKHVALIFNNVLRRQIGTRSPTVEYICTKPEILFTLMAGYEDA 134

Query: 184 --DMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
++AL+ GTMLREC R++ A+ +L S+ KFF Y+E+ F++ SDA +TF+ELLTRH
Sbjct: 135 HPEIALNSGTMLRECARYEALAKIMLHSDEFFKFFRYVEVSTFDIASDAFSTFKELLTRH 194

Query: 10 K 8
K
Sbjct: 195 K 195



Score = 33.5 bits (75), Expect(2) = 6e-25
Identities = 17/42 (40%), Positives = 27/42 (64%), Gaps = 1/42 (2%)
Frame = -3

Query: 500 DGKKEEKMADLGKNIREMKVILYGNSESEPVPE-ACTQLTQE 378
D K E+ D+ KN+ +K +LYG+S++EP + QL+QE
Sbjct: 29 DRKVEKAQEDVSKNLVSIKNMLYGSSDAEPPADYVVAQLSQE 70


>sp|O18211|MO25M_CAEEL Uncharacterized MO25-like protein Y53C12A.4
OS=Caenorhabditis elegans GN=Y53C12A.4 PE=2 SV=1
Length = 338

Score = 97.4 bits (241), Expect(2) = 2e-23
Identities = 47/120 (39%), Positives = 79/120 (65%)
Frame = -1

Query: 364 NIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNT 185
N++ +LI L K + E +KD V NL R+Q+ +R +YL + ++L L+ GY+
Sbjct: 81 NVLPMLIKHLHKFEFECKKDVASVFNNLLRRQIGTRSPTVEYLAARPEILITLLLGYEQP 140

Query: 184 DMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRHKS 5
D+AL G+MLRE +RH+ AR VL SE ++FF +++ F++ +DA +TF++L+T+HK+
Sbjct: 141 DIALTCGSMLREAVRHEHLARIVLYSEYFQRFFVFVQSDVFDIATDAFSTFKDLMTKHKN 200



Score = 30.4 bits (67), Expect(2) = 2e-23
Identities = 15/45 (33%), Positives = 24/45 (53%)
Frame = -3

Query: 512 TASRDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQE 378
T + + K E+ + + K + K +YG+ +EP E TQL QE
Sbjct: 32 TNTSERKVEKAIEETAKMLALAKTFIYGSDANEPNNEQVTQLAQE 76


>sp|Q9DB16|CB39L_MOUSE Calcium-binding protein 39-like OS=Mus
musculus GN=Cab39l PE=1 SV=3
Length = 337

Score = 105 bits (262), Expect = 1e-22
Identities = 51/114 (44%), Positives = 75/114 (65%)
Frame = -1

Query: 349 LIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNTDMALH 170
LI L +D E +KD TQ+ N+ R+Q+ +R +Y+ S+ +L +L+ GY+ +AL
Sbjct: 82 LIADLQLIDFEGKKDVTQIFNNILRRQIGTRCPTVEYISSHPHILFMLLKGYEAPQIALR 141

Query: 169 YGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRHK 8
G MLRECIRH+ A+ +L S R FF Y+E+ F++ SDA ATF++LLTRHK
Sbjct: 142 CGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHK 195


>sp|Q9H9S4|CB39L_HUMAN Calcium-binding protein 39-like OS=Homo
sapiens GN=CAB39L PE=1 SV=3
Length = 337

Score = 103 bits (258), Expect = 4e-22
Identities = 50/114 (43%), Positives = 75/114 (65%)
Frame = -1

Query: 349 LIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYDNTDMALH 170
LI L +D E +KD TQ+ N+ R+Q+ +R +Y+ ++ +L +L+ GY+ +AL
Sbjct: 82 LIADLQLIDFEGKKDVTQIFNNILRRQIGTRSPTVEYISAHPHILFMLLKGYEAPQIALR 141

Query: 169 YGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRHK 8
G MLRECIRH+ A+ +L S R FF Y+E+ F++ SDA ATF++LLTRHK
Sbjct: 142 CGIMLRECIRHEPLAKIILFSNQFRDFFKYVELSTFDIASDAFATFKDLLTRHK 195


tr_hit_id B8LRK7
Definition tr|B8LRK7|B8LRK7_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 123
Score (bit) 197.0
E-value 4.0e-66
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919369|Adiantum capillus-veneris mRNA, clone:
YMU001_000124_C11.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LRK7|B8LRK7_PICSI Putative uncharacterized protein OS=Picea... 197 4e-66
tr|A9TGL4|A9TGL4_PHYPA Predicted protein OS=Physcomitrella paten... 186 6e-63
tr|A7R1X7|A7R1X7_VITVI Chromosome undetermined scaffold_383, who... 196 8e-63
tr|Q0D536|Q0D536_ORYSJ Os07g0585100 protein OS=Oryza sativa subs... 187 2e-62
tr|B8B7U4|B8B7U4_ORYSI Putative uncharacterized protein OS=Oryza... 187 2e-62
tr|A9SDR3|A9SDR3_PHYPA Predicted protein OS=Physcomitrella paten... 186 2e-61
tr|Q2A9P5|Q2A9P5_BRAOL Mo25 family protein OS=Brassica oleracea ... 188 3e-61
tr|B3LFB8|B3LFB8_ARATH At5g47540 OS=Arabidopsis thaliana PE=2 SV=1 187 4e-61
tr|Q2A9T4|Q2A9T4_BRAOL MO25 protein-related OS=Brassica oleracea... 187 1e-60
tr|B7FKV3|B7FKV3_MEDTR Putative uncharacterized protein OS=Medic... 183 1e-60
tr|A3BLL9|A3BLL9_ORYSJ Putative uncharacterized protein OS=Oryza... 187 4e-58
tr|A7R7M8|A7R7M8_VITVI Chromosome undetermined scaffold_1890, wh... 179 1e-57
tr|A7P0G4|A7P0G4_VITVI Chromosome chr19 scaffold_4, whole genome... 178 4e-55
tr|Q2A9Y5|Q2A9Y5_BRAOL Mo25 family protein OS=Brassica oleracea ... 174 2e-53
tr|Q10R42|Q10R42_ORYSJ Os03g0172200 protein OS=Oryza sativa subs... 163 9e-52
tr|A2XD22|A2XD22_ORYSI Putative uncharacterized protein OS=Oryza... 160 2e-51
tr|B6U5L1|B6U5L1_MAIZE Calcium-binding protein 39 OS=Zea mays PE... 164 2e-50
tr|A5AJB5|A5AJB5_VITVI Putative uncharacterized protein OS=Vitis... 151 6e-45
tr|A7Q353|A7Q353_VITVI Chromosome chr12 scaffold_47, whole genom... 151 3e-42
tr|Q2A9B1|Q2A9B1_BRAOL Mo25 family protein OS=Brassica oleracea ... 167 3e-40
tr|A7NWD2|A7NWD2_VITVI Chromosome chr5 scaffold_2, whole genome ... 117 1e-28
tr|A9TS90|A9TS90_PHYPA Predicted protein OS=Physcomitrella paten... 113 2e-28
tr|A8PSK1|A8PSK1_BRUMA Cab39 protein, putative OS=Brugia malayi ... 110 2e-27
tr|Q7Z4X0|Q7Z4X0_HUMAN MO25-like protein OS=Homo sapiens PE=2 SV=1 103 4e-27
tr|A8K8L7|A8K8L7_HUMAN cDNA FLJ78295, highly similar to Homo sap... 103 4e-27
tr|Q803V8|Q803V8_DANRE Calcium binding protein 39 OS=Danio rerio... 106 5e-27
tr|Q8VDZ8|Q8VDZ8_MOUSE Cab39 protein OS=Mus musculus GN=Cab39 PE... 103 5e-27
tr|Q6IP72|Q6IP72_XENLA MGC78903 protein OS=Xenopus laevis GN=cab... 102 8e-27
tr|Q17GP0|Q17GP0_AEDAE Putative uncharacterized protein OS=Aedes... 110 8e-27
tr|Q17GN9|Q17GN9_AEDAE Putative uncharacterized protein OS=Aedes... 110 8e-27

>tr|B8LRK7|B8LRK7_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 338

Score = 197 bits (500), Expect(2) = 4e-66
Identities = 93/123 (75%), Positives = 113/123 (91%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
+ + +RLLIV L KL+LE RKD TQV+ANLQRQQVHSRLIASDYL++NKDLLDIL+AGY+
Sbjct: 75 KHDTLRLLIVHLPKLNLEVRKDVTQVVANLQRQQVHSRLIASDYLEANKDLLDILIAGYE 134

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
+TD+ALHYG+MLR+CIRHQ ARYVLES N++KFFGY+++PNFE+ SDAAATF+ELLTRH
Sbjct: 135 DTDLALHYGSMLRDCIRHQSIARYVLESGNMKKFFGYIQLPNFEIASDAAATFKELLTRH 194

Query: 10 KST 2
KST
Sbjct: 195 KST 197



Score = 78.2 bits (191), Expect(2) = 4e-66
Identities = 37/53 (69%), Positives = 45/53 (84%)
Frame = -3

Query: 533 LAYIDMPTASRDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
L Y+D ++R+ K+EEKMA+L KNIREMK +LYGNSE+EPVPEAC QLTQEF
Sbjct: 23 LGYVD--ASARELKREEKMAELAKNIREMKTVLYGNSEAEPVPEACAQLTQEF 73


>tr|A9TGL4|A9TGL4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_169973 PE=4 SV=1
Length = 334

Score = 186 bits (473), Expect(2) = 6e-63
Identities = 95/124 (76%), Positives = 105/124 (84%), Gaps = 1/124 (0%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
RE+ MRLLI L KL+LE RKD TQV+ANLQRQQV SRLIA+DYLD NKDLLD+LVAGYD
Sbjct: 74 REDAMRLLIQCLPKLELEVRKDVTQVVANLQRQQVQSRLIAADYLDRNKDLLDLLVAGYD 133

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLES-ENLRKFFGYLEIPNFEVQSDAAATFRELLTR 14
D+ALHYG MLRECIRHQ ARYVL+S +NL KFF Y+E PNFEV SDA ATF+ELLTR
Sbjct: 134 KPDLALHYGAMLRECIRHQSIARYVLDSQQNLCKFFKYIEFPNFEVASDAVATFKELLTR 193

Query: 13 HKST 2
HKST
Sbjct: 194 HKST 197



Score = 77.8 bits (190), Expect(2) = 6e-63
Identities = 35/44 (79%), Positives = 40/44 (90%)
Frame = -3

Query: 509 ASRDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQE 378
ASRD K+EEKM DL KNIR+MK++LYGNSE+EPVPEAC QLTQE
Sbjct: 28 ASRDPKREEKMVDLAKNIRDMKIVLYGNSEAEPVPEACAQLTQE 71


>tr|A7R1X7|A7R1X7_VITVI Chromosome undetermined scaffold_383, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00012467001 PE=4 SV=1
Length = 340

Score = 196 bits (499), Expect(2) = 8e-63
Identities = 91/123 (73%), Positives = 111/123 (90%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
+EN +RLLI L KL+LETRKD TQV+ANLQRQQVHSRLIASDYL++N DL+D+L++GYD
Sbjct: 77 KENTLRLLITCLPKLNLETRKDATQVVANLQRQQVHSRLIASDYLEANIDLMDVLISGYD 136

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTDMALHYG MLRECIRHQ ARYVLES +++KFF Y+++PNF++ +DAAATF+ELLTRH
Sbjct: 137 NTDMALHYGAMLRECIRHQTVARYVLESAHMKKFFDYIQLPNFDIAADAAATFKELLTRH 196

Query: 10 KST 2
KST
Sbjct: 197 KST 199



Score = 67.4 bits (163), Expect(2) = 8e-63
Identities = 32/53 (60%), Positives = 41/53 (77%)
Frame = -3

Query: 533 LAYIDMPTASRDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
L Y + + +R+ K+EEKM++L K IRE+K ILYGNSE+EP EAC QLTQEF
Sbjct: 23 LIYANRSSDTRESKREEKMSELSKLIRELKSILYGNSEAEPQAEACCQLTQEF 75


>tr|Q0D536|Q0D536_ORYSJ Os07g0585100 protein OS=Oryza sativa subsp.
japonica GN=Os07g0585100 PE=2 SV=1
Length = 336

Score = 187 bits (476), Expect(2) = 2e-62
Identities = 85/123 (69%), Positives = 112/123 (91%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
REN +RLLI+ L KL+LETRKD TQV+ANLQRQQV S+++AS+YL++NKDLLD L++GY+
Sbjct: 79 RENTLRLLIICLPKLNLETRKDATQVVANLQRQQVSSKIVASEYLEANKDLLDTLISGYE 138

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
N D+ALHYG+MLRECIRHQ ARYVLES++++KFF Y+++PNF++ SDA+ATF+ELLTRH
Sbjct: 139 NMDIALHYGSMLRECIRHQSIARYVLESDHMKKFFDYIQLPNFDIASDASATFKELLTRH 198

Query: 10 KST 2
K+T
Sbjct: 199 KAT 201



Score = 75.1 bits (183), Expect(2) = 2e-62
Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 2/55 (3%)
Frame = -3

Query: 533 LAYIDMPTASR--DGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
L ++D+ + SR D K+EEKMA+L KNIRE+K ILYGN ESEPV EAC QLTQEF
Sbjct: 23 LIFLDLHSGSRGGDAKREEKMAELSKNIRELKSILYGNGESEPVTEACVQLTQEF 77


>tr|B8B7U4|B8B7U4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_26650 PE=4 SV=1
Length = 336

Score = 187 bits (476), Expect(2) = 2e-62
Identities = 85/123 (69%), Positives = 112/123 (91%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
REN +RLLI+ L KL+LETRKD TQV+ANLQRQQV S+++AS+YL++NKDLLD L++GY+
Sbjct: 79 RENTLRLLIICLPKLNLETRKDATQVVANLQRQQVSSKIVASEYLEANKDLLDTLISGYE 138

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
N D+ALHYG+MLRECIRHQ ARYVLES++++KFF Y+++PNF++ SDA+ATF+ELLTRH
Sbjct: 139 NMDIALHYGSMLRECIRHQSIARYVLESDHMKKFFDYIQLPNFDIASDASATFKELLTRH 198

Query: 10 KST 2
K+T
Sbjct: 199 KAT 201



Score = 75.1 bits (183), Expect(2) = 2e-62
Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 2/55 (3%)
Frame = -3

Query: 533 LAYIDMPTASR--DGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
L ++D+ + SR D K+EEKMA+L KNIRE+K ILYGN ESEPV EAC QLTQEF
Sbjct: 23 LIFLDLHSGSRGGDAKREEKMAELSKNIRELKSILYGNGESEPVTEACVQLTQEF 77


>tr|A9SDR3|A9SDR3_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_211250 PE=4 SV=1
Length = 335

Score = 186 bits (471), Expect(2) = 2e-61
Identities = 94/124 (75%), Positives = 105/124 (84%), Gaps = 1/124 (0%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
RE+ MRL+I L K DLE RKD TQV+ANLQRQQV SRLIA+DYLD NKDLLD+LVAGYD
Sbjct: 74 REDAMRLMIQCLPKFDLEVRKDITQVVANLQRQQVQSRLIAADYLDRNKDLLDLLVAGYD 133

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLES-ENLRKFFGYLEIPNFEVQSDAAATFRELLTR 14
DMALHYGTMLRECIRHQ ARYVL+S ++L KFF Y+E+PNFEV SDA TF+ELLTR
Sbjct: 134 KPDMALHYGTMLRECIRHQSIARYVLDSQQHLCKFFQYIELPNFEVASDAVVTFKELLTR 193

Query: 13 HKST 2
HKST
Sbjct: 194 HKST 197



Score = 73.6 bits (179), Expect(2) = 2e-61
Identities = 31/45 (68%), Positives = 41/45 (91%)
Frame = -3

Query: 512 TASRDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQE 378
+A+RD K+EEKM ++ KN+R+MK++LYGNSE+EPVPEAC QLTQE
Sbjct: 27 SAARDPKREEKMMEVAKNVRDMKIVLYGNSEAEPVPEACAQLTQE 71


>tr|Q2A9P5|Q2A9P5_BRAOL Mo25 family protein OS=Brassica oleracea
GN=26.t00021 PE=4 SV=1
Length = 324

Score = 188 bits (477), Expect(2) = 3e-61
Identities = 86/123 (69%), Positives = 111/123 (90%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
RE+ +RLLI L KL+LETRKD TQ++ANLQRQQV+SRLIASDYL++N DL+D+L+ G++
Sbjct: 80 REDTLRLLITCLPKLNLETRKDATQLVANLQRQQVNSRLIASDYLEANLDLMDVLMEGFE 139

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTD+ALHYG M RECIRHQ+ ARYVLESE+++KFF Y+++PNF++ +DAAATF+ELLTRH
Sbjct: 140 NTDLALHYGAMFRECIRHQIVARYVLESEHVKKFFDYIQLPNFDIAADAAATFKELLTRH 199

Query: 10 KST 2
KST
Sbjct: 200 KST 202



Score = 70.5 bits (171), Expect(2) = 3e-61
Identities = 32/43 (74%), Positives = 38/43 (88%)
Frame = -3

Query: 503 RDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
R+ K+EEKMA+L +NIR+MK ILYGNSE+EPV EAC QLTQEF
Sbjct: 36 RESKREEKMAELSRNIRDMKSILYGNSEAEPVAEACAQLTQEF 78


>tr|B3LFB8|B3LFB8_ARATH At5g47540 OS=Arabidopsis thaliana PE=2 SV=1
Length = 343

Score = 187 bits (475), Expect(2) = 4e-61
Identities = 85/123 (69%), Positives = 111/123 (90%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
+E+ +RLLI L KL+LETRKD TQV+ANLQRQQV+SRLIASDYL++N DL+D+L+ G++
Sbjct: 80 KEDTLRLLITCLPKLNLETRKDATQVVANLQRQQVNSRLIASDYLEANIDLMDVLIEGFE 139

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTDMALHYG M RECIRHQ+ A+YVLES++++KFF Y+++PNF++ +DAAATF+ELLTRH
Sbjct: 140 NTDMALHYGAMFRECIRHQIVAKYVLESDHVKKFFDYIQLPNFDIAADAAATFKELLTRH 199

Query: 10 KST 2
KST
Sbjct: 200 KST 202



Score = 70.9 bits (172), Expect(2) = 4e-61
Identities = 32/43 (74%), Positives = 38/43 (88%)
Frame = -3

Query: 503 RDGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
RD K++EKMA+L +NIR+MK ILYGNSE+EPV EAC QLTQEF
Sbjct: 36 RDSKRDEKMAELSRNIRDMKSILYGNSEAEPVAEACAQLTQEF 78


>tr|Q2A9T4|Q2A9T4_BRAOL MO25 protein-related OS=Brassica oleracea
GN=25.t00014 PE=4 SV=1
Length = 340

Score = 187 bits (476), Expect(2) = 1e-60
Identities = 85/123 (69%), Positives = 111/123 (90%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
RE+ +RLLI L KL+LETRKD TQV+ANLQRQQV+S+LIASDYL++N DL+D+L+ G++
Sbjct: 77 REDTLRLLITCLPKLNLETRKDATQVVANLQRQQVNSKLIASDYLEANLDLMDVLIEGFE 136

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTD+ALHYG M RECIRHQ+ A+YVLESE+++KFF Y+++PNF++ +DAAATF+ELLTRH
Sbjct: 137 NTDLALHYGAMFRECIRHQIVAKYVLESEHVKKFFDYIQLPNFDIAADAAATFKELLTRH 196

Query: 10 KST 2
KST
Sbjct: 197 KST 199



Score = 68.9 bits (167), Expect(2) = 1e-60
Identities = 31/42 (73%), Positives = 37/42 (88%)
Frame = -3

Query: 500 DGKKEEKMADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
D K++EKMA+L +NIR+MK ILYGNSE+EPV EAC QLTQEF
Sbjct: 34 DSKRDEKMAELSRNIRDMKSILYGNSEAEPVAEACAQLTQEF 75


>tr|B7FKV3|B7FKV3_MEDTR Putative uncharacterized protein OS=Medicago
truncatula PE=2 SV=1
Length = 337

Score = 183 bits (464), Expect(2) = 1e-60
Identities = 83/123 (67%), Positives = 107/123 (86%)
Frame = -1

Query: 370 RENIMRLLIVLLSKLDLETRKDTTQVIANLQRQQVHSRLIASDYLDSNKDLLDILVAGYD 191
+EN +RLLI + KL+LE RKD TQV+ANLQRQ V S+LIASDYL++N DL+DIL+ GY+
Sbjct: 78 KENTLRLLIKCIPKLNLEARKDATQVVANLQRQPVQSKLIASDYLENNMDLMDILIVGYE 137

Query: 190 NTDMALHYGTMLRECIRHQVAARYVLESENLRKFFGYLEIPNFEVQSDAAATFRELLTRH 11
NTDMALHYG MLRECIRHQ+ A+YVL S +++KFF Y+++PNF++ +DAAATF+EL+TRH
Sbjct: 138 NTDMALHYGAMLRECIRHQIVAKYVLNSPHMKKFFDYIQLPNFDIAADAAATFKELMTRH 197

Query: 10 KST 2
KST
Sbjct: 198 KST 200



Score = 73.6 bits (179), Expect(2) = 1e-60
Identities = 38/54 (70%), Positives = 42/54 (77%), Gaps = 1/54 (1%)
Frame = -3

Query: 533 LAYIDMPTASRDGKKEEK-MADLGKNIREMKVILYGNSESEPVPEACTQLTQEF 375
L + D T SRD K+EEK M +L KNIRE+K ILYGNSESEPV EAC QLTQEF
Sbjct: 23 LLFFDRNTESRDSKREEKQMTELCKNIRELKSILYGNSESEPVSEACAQLTQEF 76