BP919384
Clone id YMU001_000124_E05
Library
Length 553
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000124_E05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CATGCCATCTGCTCTCATCGACCGGGTGATCCAGCCATAAACTCCCACCAAAAGACTACG
TTTTCAGCTTTGATATCCACAAATCCCGCCACATTTTGATCTTCTCAGTCCCACATTTTG
AGGCCGCAAAAAATTGAGAAATCATATAGTAACTTTTCCCCATCCTTTGACACAACCTTA
CAACTACAATATCTCAGCCCTCATGATTCCATTTGATGAGCCACCAATTTTGGCTAATCC
CATACAATGCAATGAGATTCTAGAACCCAGTTGTGGCCCAAAATCTCTCGATGGGCATGC
TTCCCAATGCGCGCAAGTTGGCCCATAACTGGCCCCCGACAAACATTCAACTGCCCATAA
CTTTTCCTCTGGAGCTTCAATTGACAATCCAAAAAGACCGGCATGCTCTTTAATCCCATC
CACTGAGACCAACTTTGGCTGTGGGATGGGTTTTTTGAGCTCACTCTTATCTTATTGCAG
ACATAGCAAGAACCACGAACATAATTGTCAATGCATGGGACGAATCTGACTCGACTATTG
CATAGAGGCTACA
■■Homology search results ■■ -
sp_hit_id P04701
Definition sp|P04701|ZEAL_MAIZE Zein-alpha Z4 OS=Zea mays
Align length 66
Score (bit) 32.7
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919384|Adiantum capillus-veneris mRNA, clone:
YMU001_000124_E05.
(553 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P04701|ZEAL_MAIZE Zein-alpha Z4 OS=Zea mays PE=3 SV=2 33 1.2
sp|P04704|ZEA2_MAIZE Zein-alpha ZG99 OS=Zea mays PE=2 SV=1 33 1.2
sp|P04275|VWF_HUMAN von Willebrand factor OS=Homo sapiens GN=VWF... 31 3.5
sp|Q5TJE7|WDR46_CANFA WD repeat-containing protein 46 OS=Canis f... 31 4.6
sp|P06674|ZEA3_MAIZE Zein-alpha 19A2 (Fragment) OS=Zea mays PE=2... 30 6.0
sp|Q9Z0H1|WDR46_MOUSE WD repeat-containing protein 46 OS=Mus mus... 30 6.0
sp|Q02958|KRA61_SHEEP Keratin, glycine/tyrosine-rich of hair OS=... 30 7.9

>sp|P04701|ZEAL_MAIZE Zein-alpha Z4 OS=Zea mays PE=3 SV=2
Length = 267

Score = 32.7 bits (73), Expect = 1.2
Identities = 24/66 (36%), Positives = 33/66 (50%), Gaps = 6/66 (9%)
Frame = +1

Query: 34 AINSH------QKTTFSALISTNPATF*SSQSHILRPQKIEKSYSNFSPSFDTTLQLQYL 195
A+NSH Q FS L + +PA F +Q H+L Y + +P+ T LQLQ L
Sbjct: 190 ALNSHAYVQQQQLLPFSQLAAVSPAAF-LTQQHLL------PFYLHTAPNVGTLLQLQQL 242

Query: 196 SPHDSI 213
P D +
Sbjct: 243 LPFDQL 248


>sp|P04704|ZEA2_MAIZE Zein-alpha ZG99 OS=Zea mays PE=2 SV=1
Length = 235

Score = 32.7 bits (73), Expect = 1.2
Identities = 23/66 (34%), Positives = 32/66 (48%), Gaps = 6/66 (9%)
Frame = +1

Query: 34 AINSH------QKTTFSALISTNPATF*SSQSHILRPQKIEKSYSNFSPSFDTTLQLQYL 195
A+NSH Q FS L + +PA F L Q++ Y + +P+ T LQLQ L
Sbjct: 158 ALNSHAYVQQQQLLPFSQLAAVSPAAF-------LTQQQLLPFYLHTAPNVGTLLQLQQL 210

Query: 196 SPHDSI 213
P D +
Sbjct: 211 LPFDQL 216


>sp|P04275|VWF_HUMAN von Willebrand factor OS=Homo sapiens GN=VWF PE=1
SV=2
Length = 2813

Score = 31.2 bits (69), Expect = 3.5
Identities = 28/91 (30%), Positives = 33/91 (36%), Gaps = 3/91 (3%)
Frame = +2

Query: 179 YNYNISALMIPFDEPPILANPIQCNEILEPSCGP-KSLDGHASQCAQVGP*LAPDKHSTA 355
YN A + P LA P+QC E C P K LD C V P P
Sbjct: 1146 YNSCAPACQVTCQHPEPLACPVQCVEGCHAHCPPGKILDELLQTC--VDPEDCPVCEVAG 1203

Query: 356 HNFSSGASID-NPKRPA-CSLIPSTETNFGC 442
F+SG + NP P C + N C
Sbjct: 1204 RRFASGKKVTLNPSDPEHCQICHCDVVNLTC 1234


>sp|Q5TJE7|WDR46_CANFA WD repeat-containing protein 46 OS=Canis
familiaris GN=WDR46 PE=3 SV=1
Length = 612

Score = 30.8 bits (68), Expect = 4.6
Identities = 13/48 (27%), Positives = 28/48 (58%)
Frame = -1

Query: 250 ALYGISQNWWLIKWNHEG*DIVVVRLCQRMGKSYYMISQFFAASKCGT 107
AL+ ++QN WL ++++G ++ +R C R+ + ++ F A+ T
Sbjct: 250 ALFAVAQNRWLHIYDNQGIELHCIRRCDRVTRLEFLPFHFLLATASET 297


>sp|P06674|ZEA3_MAIZE Zein-alpha 19A2 (Fragment) OS=Zea mays PE=2
SV=1
Length = 230

Score = 30.4 bits (67), Expect = 6.0
Identities = 19/59 (32%), Positives = 27/59 (45%)
Frame = +1

Query: 37 INSHQKTTFSALISTNPATF*SSQSHILRPQKIEKSYSNFSPSFDTTLQLQYLSPHDSI 213
+ Q FS L +PA F L Q++ Y + +P+ T LQLQ L P D +
Sbjct: 160 LQQQQLPPFSQLADVSPAAF-------LTQQQLLPFYLHAAPNAGTVLQLQQLLPFDQL 211


>sp|Q9Z0H1|WDR46_MOUSE WD repeat-containing protein 46 OS=Mus
musculus GN=Wdr46 PE=2 SV=1
Length = 622

Score = 30.4 bits (67), Expect = 6.0
Identities = 16/64 (25%), Positives = 35/64 (54%)
Frame = -1

Query: 250 ALYGISQNWWLIKWNHEG*DIVVVRLCQRMGKSYYMISQFFAASKCGTEKIKMWRDLWIS 71
AL ++QN WL ++++G ++ +R C R+ + ++ F A+ T + + D+ +
Sbjct: 248 ALLAVAQNRWLYIYDNQGIELHCIRRCDRVTRLEFLPFHFLLATTSETGFL-TYLDVSVG 306

Query: 70 KLKT 59
K+ T
Sbjct: 307 KIVT 310


>sp|Q02958|KRA61_SHEEP Keratin, glycine/tyrosine-rich of hair
OS=Ovis aries GN=KAP6-1 PE=1 SV=2
Length = 83

Score = 30.0 bits (66), Expect = 7.9
Identities = 16/36 (44%), Positives = 19/36 (52%)
Frame = -2

Query: 111 GLRRSKCGGICGYQS*KRSLLVGVYGWITRSMRADG 4
G RR CG CGY RSL YG+ +RS+ G
Sbjct: 33 GFRRLGCGYGCGYGYGSRSLCGSGYGYGSRSLCGSG 68


tr_hit_id Q22534
Definition tr|Q22534|Q22534_CAEEL Gex interacting protein protein 16, isoform d OS=Caenorhabditis elegans
Align length 83
Score (bit) 36.2
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919384|Adiantum capillus-veneris mRNA, clone:
YMU001_000124_E05.
(553 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q22534|Q22534_CAEEL Gex interacting protein protein 16, isofo... 36 1.2
tr|Q318G9|Q318G9_PROM9 DNA replication and repair protein recF O... 36 1.5
tr|B1VNB3|B1VNB3_STRGG Putative endonuclease VII OS=Streptomyces... 35 2.6
tr|A2Q951|A2Q951_ASPNC Catalytic activity: NADH + 2 ferricytochr... 35 2.7
tr|A7QW02|A7QW02_VITVI Chromosome chr2 scaffold_196, whole genom... 35 3.5
tr|A8G777|A8G777_PROM2 DNA replication and repair protein recF O... 34 4.5
tr|A3PF62|A3PF62_PROM0 DNA replication and repair protein recF O... 34 4.5
tr|Q1PK84|Q1PK84_PROMA DNA replication and repair protein recF O... 34 4.5
tr|Q0USG0|Q0USG0_PHANO Putative uncharacterized protein OS=Phaeo... 34 6.0
tr|B4N425|B4N425_DROWI GK11362 OS=Drosophila willistoni GN=GK113... 33 7.8
tr|A8Y182|A8Y182_CAEBR Putative uncharacterized protein OS=Caeno... 33 7.8
tr|A2BTF2|A2BTF2_PROMS DNA replication and repair protein recF O... 33 10.0
tr|B6PVW8|B6PVW8_BRAFL Putative uncharacterized protein OS=Branc... 33 10.0

>tr|Q22534|Q22534_CAEEL Gex interacting protein protein 16, isoform d
OS=Caenorhabditis elegans GN=gei-16 PE=1 SV=3
Length = 1030

Score = 36.2 bits (82), Expect = 1.2
Identities = 27/83 (32%), Positives = 38/83 (45%), Gaps = 3/83 (3%)
Frame = +2

Query: 77 PQIPPHFDLLSPTF*GRKKLRNHIVTFPHPLTQPYNYNISALMIPFDEPP--ILANPIQC 250
PQ H PT G + RN+I P PY+Y+ + +P PP LA+PI
Sbjct: 919 PQHHHHHHSQRPTTPGATRARNYIARATAPSPTPYSYDRARAYVPPALPPGYRLADPIPD 978

Query: 251 NEILEPSCG-PKSLDGHASQCAQ 316
+ PS G + L + S+ AQ
Sbjct: 979 QRAMSPSPGHTRKLIRNVSESAQ 1001


>tr|Q318G9|Q318G9_PROM9 DNA replication and repair protein recF
OS=Prochlorococcus marinus (strain MIT 9312)
GN=PMT9312_1665 PE=3 SV=1
Length = 297

Score = 35.8 bits (81), Expect = 1.5
Identities = 15/49 (30%), Positives = 25/49 (51%)
Frame = -3

Query: 512 IDNYVRGSCYVCNKIRVSSKNPSHSQSWSQWMGLKSMPVFLDCQLKLQR 366
I NY+R C+ N I + PS+ ++W + + PV+LD + R
Sbjct: 39 IKNYIRSVCFCSNDINIVRSEPSYRRTWIDKVVFQLEPVYLDLISRFNR 87


>tr|B1VNB3|B1VNB3_STRGG Putative endonuclease VII OS=Streptomyces
griseus subsp. griseus (strain JCM 4626 / NBRC 13350)
GN=SGR_107t PE=4 SV=1
Length = 394

Score = 35.0 bits (79), Expect = 2.6
Identities = 18/51 (35%), Positives = 26/51 (50%), Gaps = 2/51 (3%)
Frame = -3

Query: 479 CNKIRVSSKNPSHSQSWS--QWMGLKSMPVFLDCQLKLQRKSYGQLNVCRG 333
C ++ NP H +WS QWM + LD KL+R+ GQ ++C G
Sbjct: 145 CGHHVIAGTNPLHLLTWSGRQWMVPAAYAALLDRSEKLERQLAGQASLCSG 195


>tr|A2Q951|A2Q951_ASPNC Catalytic activity: NADH + 2 ferricytochrome
b5 <=> NAD(+) + 2 ferrocytochrome b5. OS=Aspergillus
niger (strain CBS 513.88 / FGSC A1513) GN=An01g06660
PE=3 SV=1
Length = 350

Score = 35.0 bits (79), Expect = 2.7
Identities = 26/85 (30%), Positives = 41/85 (48%), Gaps = 2/85 (2%)
Frame = +2

Query: 164 PLTQPYNYN--ISALMIPFDEPPILANPIQCNEILEPSCGPKSLDGHASQCAQVGP*LAP 337
P QP N + + ++P PP +NP + + ++ P P+ L ASQ P LAP
Sbjct: 116 PPFQPLNQTKMVDSTLMPPPPPPQQSNPAKSSSLMPPPAPPR-LRPIASQTTS-APSLAP 173

Query: 338 DKHSTAHNFSSGASIDNPKRPACSL 412
++ N +S +S+ P A SL
Sbjct: 174 GRYPPRPNNTSSSSLRPPPSAAASL 198


>tr|A7QW02|A7QW02_VITVI Chromosome chr2 scaffold_196, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00007627001
PE=4 SV=1
Length = 282

Score = 34.7 bits (78), Expect = 3.5
Identities = 18/64 (28%), Positives = 33/64 (51%), Gaps = 4/64 (6%)
Frame = -1

Query: 256 LIALYGISQNWW----LIKWNHEG*DIVVVRLCQRMGKSYYMISQFFAASKCGTEKIKMW 89
++++YG N W L+KW+H + ++ Q + M +QF ++ E+I+ W
Sbjct: 153 ILSIYGSHSNGWDANTLVKWSHRCPWKAIAQVFQE----FSMFTQFVVGNE---ERIRFW 205

Query: 88 RDLW 77
DLW
Sbjct: 206 EDLW 209


>tr|A8G777|A8G777_PROM2 DNA replication and repair protein recF
OS=Prochlorococcus marinus (strain MIT 9215) GN=recF
PE=3 SV=1
Length = 297

Score = 34.3 bits (77), Expect = 4.5
Identities = 15/49 (30%), Positives = 25/49 (51%)
Frame = -3

Query: 512 IDNYVRGSCYVCNKIRVSSKNPSHSQSWSQWMGLKSMPVFLDCQLKLQR 366
I NY+R C+ N I + PS+ ++W + + PV+LD + R
Sbjct: 39 IKNYIRSVCFCSNDIDIVRSEPSYRRTWIDKVVSQLEPVYLDLISRFNR 87


>tr|A3PF62|A3PF62_PROM0 DNA replication and repair protein recF
OS=Prochlorococcus marinus (strain MIT 9301) GN=recF
PE=3 SV=1
Length = 265

Score = 34.3 bits (77), Expect = 4.5
Identities = 15/49 (30%), Positives = 25/49 (51%)
Frame = -3

Query: 512 IDNYVRGSCYVCNKIRVSSKNPSHSQSWSQWMGLKSMPVFLDCQLKLQR 366
I NY+R C+ N I + PS+ ++W + + PV+LD + R
Sbjct: 7 IKNYIRSVCFCSNDIDIVRSEPSYRRTWIDKVVSQLEPVYLDLISRFNR 55


>tr|Q1PK84|Q1PK84_PROMA DNA replication and repair protein recF
OS=uncultured Prochlorococcus marinus clone HF10-11H11
GN=recF PE=3 SV=1
Length = 297

Score = 34.3 bits (77), Expect = 4.5
Identities = 15/49 (30%), Positives = 25/49 (51%)
Frame = -3

Query: 512 IDNYVRGSCYVCNKIRVSSKNPSHSQSWSQWMGLKSMPVFLDCQLKLQR 366
I NY+R C+ N I + PS+ ++W + + PV+LD + R
Sbjct: 39 IKNYIRSVCFCSNDIDIVRSEPSYRRTWIDKVVSQLEPVYLDLISRFNR 87


>tr|Q0USG0|Q0USG0_PHANO Putative uncharacterized protein
OS=Phaeosphaeria nodorum GN=SNOG_05304 PE=4 SV=2
Length = 351

Score = 33.9 bits (76), Expect = 6.0
Identities = 16/39 (41%), Positives = 24/39 (61%)
Frame = -1

Query: 346 MFVGGQLWANLRALGSMPIERFWATTGF*NLIALYGISQ 230
+F+GGQL+ L L S+P E FW T L+A Y +++
Sbjct: 129 VFLGGQLFTGLAVLLSLPFECFWYATPSLLLVATYPLAK 167


>tr|B4N425|B4N425_DROWI GK11362 OS=Drosophila willistoni GN=GK11362
PE=4 SV=1
Length = 1235

Score = 33.5 bits (75), Expect = 7.8
Identities = 21/68 (30%), Positives = 29/68 (42%), Gaps = 6/68 (8%)
Frame = +2

Query: 158 PHPLTQPYNYNISALMIPFDE------PPILANPIQCNEILEPSCGPKSLDGHASQCAQV 319
P P+ PYNY + + +P + PP NE+ EP + H+SQ QV
Sbjct: 132 PRPIPLPYNYPVHSYAMPVIQSLSSVAPPPFPPVTAANEMFEPQ---QQAAQHSSQALQV 188

Query: 320 GP*LAPDK 343
P P K
Sbjct: 189 APIPTPKK 196