BP919435
Clone id YMU001_000125_A12
Library
Length 551
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000125_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTCAAATGTGCACTTTTACCACAGAAAATTACAAGGGTAAATCAGGCTCCATACTTAACA
ATCTCCCACTTGGAGACTGATCTCCAAACCAAACCTGTGAGACTGCTTTCCATTCTGGCT
TCTTATCCTTGAATGCCGATTGAAGATGAGCAAAAGCTCAACTTCTCCTTGTTGACCACC
TTTGTAAACATGTCTGCGGGATTTTCACCTGTATGCACCTTTCCTAGCTTTAGCTGTCCC
TCTTCCAAAAGAGTACGTATGAAGTGATATCTCACCTCAATGTGCTTTTTCCTTGAATGA
AAGACTGAGTTCTTCGCAAGATGGATAGCGCTTTGGCTATCACTGTACAAGACACAATTG
TCTTGTTTGAATCCAAGCTCTTCTAAGAATCTGTGAAGCCACAGAATTTCTTTGCTTGCC
TTCGTCATTGCTACATACTCTACTTCCGTGGTAGAAAGTGAAACCACTTTCTGCAGCTTT
GAAGCCCAGCTTACTGCTGTGCCTCCAACCATGAACACATAGCCAGTAGTGCTCCTTTGA
GTATCTTTGTC
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 140
Score (bit) 166.0
E-value 5.0e-41
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919435|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_A12.
(551 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 166 5e-41
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 91 5e-18
sp|P92519|M810_ARATH Uncharacterized mitochondrial protein AtMg0... 48 4e-05
sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W O... 39 0.013
sp|Q7T6Y8|RIR1_MIMIV Ribonucleoside-diphosphate reductase large ... 32 2.7
sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii GN... 31 4.6
sp|P50444|YNU6_CAEEL Uncharacterized protein R74.6 OS=Caenorhabd... 31 4.6
sp|P53911|EAF7_YEAST Chromatin modification-related protein EAF7... 31 4.6

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 166 bits (421), Expect = 5e-41
Identities = 77/140 (55%), Positives = 104/140 (74%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D ++S+TGY+F G A+SW SKLQK V+LSTTE EY+A T+ KE++WL RFL+ELG
Sbjct: 1186 DIDNRKSSTGYLFTFSGGAISWQSKLQKCVALSTTEAEYIAATETGKEMIWLKRFLQELG 1245

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
Q V+Y DSQSAI L+KNS++H+R KHI+VRYH+IR ++++ LK+ K+ T ENPAD
Sbjct: 1246 LHQKEYVVYCDSQSAIDLSKNSMYHARTKHIDVRYHWIREMVDDESLKVLKISTNENPAD 1305

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TKVV + K C +G+
Sbjct: 1306 MLTKVVPRNKFELCKELVGM 1325


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster GN=GIP
PE=1 SV=3
Length = 1409

Score = 90.5 bits (223), Expect = 5e-18
Identities = 47/122 (38%), Positives = 72/122 (59%), Gaps = 2/122 (1%)
Frame = -1

Query: 539 QRSTTGYVF-MVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELGFKQ 363
++STTGY+F M + W +K Q V+ S+TE EY+A+ +A +E LWL L + K
Sbjct: 1263 RKSTTGYLFKMFDFNLICWNTKRQNSVAASSTEAEYMALFEAVREALWLKFLLTSINIKL 1322

Query: 362 DNCV-LYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPADMF 186
+N + +Y D+Q I +A N H R KHI+++YHF R ++ + L + T AD+F
Sbjct: 1323 ENPIKIYEDNQGCISIANNPSCHKRAKHIDIKYHFAREQVQNNVICLEYIPTENQLADIF 1382

Query: 185 TK 180
TK
Sbjct: 1383 TK 1384


>sp|P92519|M810_ARATH Uncharacterized mitochondrial protein
AtMg00810 OS=Arabidopsis thaliana GN=AtMg00810 PE=4 SV=1
Length = 240

Score = 47.8 bits (112), Expect = 4e-05
Identities = 21/48 (43%), Positives = 31/48 (64%)
Frame = -1

Query: 542 TQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILW 399
T+RSTTG+ +G +SW++K Q VS S+TE EY A+ + E+ W
Sbjct: 178 TRRSTTGFCTFLGCNIISWSAKRQPTVSRSSTETEYRALALTAAELTW 225


>sp|P25600|YCH4_YEAST Putative transposon Ty5-1 protein YCL074W
OS=Saccharomyces cerevisiae GN=TY5A PE=4 SV=2
Length = 308

Score = 39.3 bits (90), Expect = 0.013
Identities = 19/48 (39%), Positives = 30/48 (62%), Gaps = 1/48 (2%)
Frame = -1

Query: 545 DTQRSTTGYVFMVGGTAVSWAS-KLQKVVSLSTTEVEYVAMTKASKEI 405
D ST GYV ++ G V+W+S KL+ V+ + +TE EY+ ++ EI
Sbjct: 261 DLPHSTGGYVTLLAGAPVTWSSKKLKGVIPVPSTEAEYITASETVMEI 308


>sp|Q7T6Y8|RIR1_MIMIV Ribonucleoside-diphosphate reductase large
chain OS=Acanthamoeba polyphaga mimivirus GN=RNR1 PE=3
SV=2
Length = 881

Score = 31.6 bits (70), Expect = 2.7
Identities = 30/88 (34%), Positives = 41/88 (46%), Gaps = 1/88 (1%)
Frame = -3

Query: 321 SCEELSLSFKEKAH*GEISLHTYSFGRGTAKAR-KGAYR*KSRRHVYKGGQQGEVELLLI 145
S EE+S +KE A IS H G R +GAY ++ G+ G + +L I
Sbjct: 295 SLEEISECWKECAL---ISKHAGGIGIHMTNIRVEGAYIASTQ------GEAGGLRVLTI 345

Query: 144 FNRHSRIRSQNGKQSHRFGLEISLQVGD 61
FN SR +Q GK+ F + I GD
Sbjct: 346 FNDISRYANQGGKRPGSFAIFIEPWHGD 373


>sp|Q5RAM9|ZN664_PONAB Zinc finger protein 664 OS=Pongo abelii
GN=ZNF664 PE=2 SV=1
Length = 261

Score = 30.8 bits (68), Expect = 4.6
Identities = 27/99 (27%), Positives = 42/99 (42%), Gaps = 15/99 (15%)
Frame = -3

Query: 522 LCVHGWRHSSKLGFKAAESGFTFYHGSRVCSNDEGKQRNSVASQILR-----RAWIQTRQ 358
LC+H H+ + FK E G F H S +C + QR ++ + +A+ Q+
Sbjct: 130 LCMHQRVHTGEKPFKCEECGKAFRHTSSLCMH----QRVHTGEKLYKCYECGKAFSQSSS 185

Query: 357 LCL---VQ**PKRYPSC-------EELSLSFKEKAH*GE 271
LC+ V K Y C + SL ++ H GE
Sbjct: 186 LCIHQRVHTGEKPYRCCGCGKAFSQSSSLCIHQRVHTGE 224


>sp|P50444|YNU6_CAEEL Uncharacterized protein R74.6
OS=Caenorhabditis elegans GN=R74.6 PE=2 SV=1
Length = 381

Score = 30.8 bits (68), Expect = 4.6
Identities = 35/110 (31%), Positives = 59/110 (53%), Gaps = 9/110 (8%)
Frame = -1

Query: 515 FMVGGTAVSWASKLQKVVSLSTTEVEY-VAMTKASKEILWLHRFLEELGFKQD------N 357
FM+ ++ + L++V L T +V +A TKA E+ L++FLE + + D N
Sbjct: 240 FMLTHSSSGFKHALKEV--LETPQVALRLADTKAQGEVKALNQFLELMSTEPDRAFYGFN 297

Query: 356 CVLYSDSQSAIH--LAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVH 213
V ++ + AI L +S+F R + IE R ++R L+E + + GKVH
Sbjct: 298 HVNRANQELAIETLLVADSLF--RAQDIETRRKYVR-LVESVREQNGKVH 344


>sp|P53911|EAF7_YEAST Chromatin modification-related protein EAF7
OS=Saccharomyces cerevisiae GN=EAF7 PE=1 SV=1
Length = 425

Score = 30.8 bits (68), Expect = 4.6
Identities = 19/54 (35%), Positives = 30/54 (55%)
Frame = -1

Query: 254 TLLEEGQLKLGKVHTGENPADMFTKVVNKEKLSFCSSSIGIQG*EARMESSLTG 93
TLL++ +KLGKV T ++ D ++ N EK+ ++ + EA ESS G
Sbjct: 47 TLLQKETMKLGKVFTAKDIWDKLSQSYNLEKIDEMENTYSL---EATTESSRNG 97


tr_hit_id A5B0V5
Definition tr|A5B0V5|A5B0V5_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 140
Score (bit) 178.0
E-value 2.0e-43
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919435|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_A12.
(551 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5B0V5|A5B0V5_VITVI Putative uncharacterized protein OS=Vitis... 178 2e-43
tr|A5CBM1|A5CBM1_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5C6L3|A5C6L3_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5BML3|A5BML3_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5BIC7|A5BIC7_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5B5N4|A5B5N4_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5AM64|A5AM64_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5AGF7|A5AGF7_VITVI Putative uncharacterized protein OS=Vitis... 177 4e-43
tr|A5CAX7|A5CAX7_VITVI Putative uncharacterized protein OS=Vitis... 176 6e-43
tr|A5BA89|A5BA89_VITVI Putative uncharacterized protein OS=Vitis... 176 6e-43
tr|A5BK92|A5BK92_VITVI Putative uncharacterized protein OS=Vitis... 176 7e-43
tr|A5BGX3|A5BGX3_VITVI Putative uncharacterized protein OS=Vitis... 176 7e-43
tr|A5BHI5|A5BHI5_VITVI Putative uncharacterized protein OS=Vitis... 175 1e-42
tr|A5AZL1|A5AZL1_VITVI Putative uncharacterized protein OS=Vitis... 175 1e-42
tr|A5AK46|A5AK46_VITVI Putative uncharacterized protein OS=Vitis... 175 1e-42
tr|A5B1S3|A5B1S3_VITVI Putative uncharacterized protein OS=Vitis... 175 2e-42
tr|A5AVU6|A5AVU6_VITVI Putative uncharacterized protein OS=Vitis... 175 2e-42
tr|A5C844|A5C844_VITVI Putative uncharacterized protein OS=Vitis... 174 2e-42
tr|A5BPB3|A5BPB3_VITVI Putative uncharacterized protein OS=Vitis... 174 2e-42
tr|A5BJT3|A5BJT3_VITVI Putative uncharacterized protein OS=Vitis... 174 2e-42
tr|A5AS37|A5AS37_VITVI Putative uncharacterized protein OS=Vitis... 174 2e-42
tr|A5BJQ3|A5BJQ3_VITVI Putative uncharacterized protein OS=Vitis... 174 3e-42
tr|A5AYT3|A5AYT3_VITVI Putative uncharacterized protein OS=Vitis... 174 3e-42
tr|A5BFU1|A5BFU1_VITVI Putative uncharacterized protein OS=Vitis... 174 4e-42
tr|A5CAL2|A5CAL2_VITVI Putative uncharacterized protein OS=Vitis... 173 5e-42
tr|A5BBW7|A5BBW7_VITVI Putative uncharacterized protein OS=Vitis... 173 5e-42
tr|A5AER2|A5AER2_VITVI Putative uncharacterized protein OS=Vitis... 173 6e-42
tr|A5C9A6|A5C9A6_VITVI Putative uncharacterized protein OS=Vitis... 172 8e-42
tr|A5BC16|A5BC16_VITVI Putative uncharacterized protein OS=Vitis... 172 8e-42
tr|Q6BCY1|Q6BCY1_IPOBA Gag-Pol OS=Ipomoea batatas GN=Rtsp-1AA PE... 172 1e-41

>tr|A5B0V5|A5B0V5_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_008497 PE=4 SV=1
Length = 1149

Score = 178 bits (451), Expect = 2e-43
Identities = 85/140 (60%), Positives = 112/140 (80%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG++F +GGTA+SW S LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1008 DIDSRKSTTGFIFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1067

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNSVFHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1068 KKQEMGILHSDSQSAIFLAKNSVFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1127

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1128 MLTKGVTIEKLKLCAASIGL 1147


>tr|A5CBM1|A5CBM1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_001479 PE=4 SV=1
Length = 1246

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SW S LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1105 DIDSRKSTTGFVFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1164

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1165 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1224

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1225 MLTKGVTIEKLKLCAASIGL 1244


>tr|A5C6L3|A5C6L3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_040966 PE=4 SV=1
Length = 1212

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SW S LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1071 DIDSRKSTTGFVFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1130

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1131 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1190

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1191 MLTKGVTIEKLKLCAASIGL 1210


>tr|A5BML3|A5BML3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_008416 PE=4 SV=1
Length = 1001

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF GGTA+SW S LQK+V+LSTTEVEY+A T+A KE++WLH FL+ELG
Sbjct: 860 DIDSRKSTTGFVFTPGGTAISWTSNLQKIVTLSTTEVEYIAATEAGKEMIWLHGFLDELG 919

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNSVFHS+ KHI+ +YHFIR L+E+ + L K+ +NP D
Sbjct: 920 KKQEMGILHSDSQSAIFLAKNSVFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPVD 979

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 980 MLTKGVTIEKLKLCAASIGL 999


>tr|A5BIC7|A5BIC7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024822 PE=4 SV=1
Length = 1250

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SW S LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1109 DIDSRKSTTGFVFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1168

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1169 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1228

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1229 MLTKGVTIEKLKLCAASIGL 1248


>tr|A5B5N4|A5B5N4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005765 PE=4 SV=1
Length = 1261

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SW S LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1120 DIDSRKSTTGFVFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1179

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1180 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1239

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1240 MLTKGVTIEKLKLCAASIGL 1259


>tr|A5AM64|A5AM64_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037436 PE=4 SV=1
Length = 1183

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGT +SWAS LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1042 DIDSRKSTTGFVFTLGGTTISWASNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1101

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1102 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1161

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1162 MLTKGVTIEKLKLCTASIGL 1181


>tr|A5AGF7|A5AGF7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_042009 PE=4 SV=1
Length = 222

Score = 177 bits (448), Expect = 4e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SWAS LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 81 DIDSRKSTTGFVFTLGGTAISWASNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 140

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NP D
Sbjct: 141 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPTD 200

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 201 MLTKGVTIEKLKLCAASIGL 220


>tr|A5CAX7|A5CAX7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_035336 PE=4 SV=1
Length = 1244

Score = 176 bits (447), Expect = 6e-43
Identities = 85/140 (60%), Positives = 110/140 (78%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SW S LQK+V+LSTTE EYVA T+A KE +WLH FL+ELG
Sbjct: 1103 DIDSRKSTTGFVFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEXIWLHGFLDELG 1162

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1163 KKQEMGILHSDSQSAIFLAKNSAFHSKSKHIQTKYHFIRYLVEDKXVILEKICGSKNPAD 1222

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1223 MLTKGVTIEKLKLCAASIGL 1242


>tr|A5BA89|A5BA89_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_043997 PE=4 SV=1
Length = 1269

Score = 176 bits (447), Expect = 6e-43
Identities = 85/140 (60%), Positives = 111/140 (79%)
Frame = -1

Query: 551 DKDTQRSTTGYVFMVGGTAVSWASKLQKVVSLSTTEVEYVAMTKASKEILWLHRFLEELG 372
D D+++STTG+VF +GGTA+SW S LQK+V+LSTTE EYVA T+A KE++WLH FL+ELG
Sbjct: 1128 DIDSRKSTTGFVFTLGGTAISWTSNLQKIVTLSTTEAEYVAATEAGKEMIWLHGFLDELG 1187

Query: 371 FKQDNCVLYSDSQSAIHLAKNSVFHSRKKHIEVRYHFIRTLLEEGQLKLGKVHTGENPAD 192
KQ+ +L+SDSQSAI LAKNS FHS+ KHI+ +YHFIR L+E+ + L K+ +NPAD
Sbjct: 1188 KKQEMGILHSDSQSAIFLAKNSXFHSKSKHIQTKYHFIRYLVEDKLVILEKICGSKNPAD 1247

Query: 191 MFTKVVNKEKLSFCSSSIGI 132
M TK V EKL C++SIG+
Sbjct: 1248 MLTKGVTIEKLKLCAASIGL 1267