BP919473
Clone id YMU001_000125_E04
Library
Length 445
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000125_E04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTACACACACATGCCACCTTTTTGTTTCATTATACAAAAAATTGCTACACAAAAGAACCT
CAACTAGTGAGGCACTTTTTTACAACGGAAAAGAAAATCTTCTAGCTCAACTAGTTCAGT
ATACAACATATTTGAGCCATCTAGCTGATTTACACTCAAAGAATCAACGGTTACATGCCT
TTGCAAACCTTTTGTACACACCTTCCACAGAGAAACAATCACAAAGTGATTCTATCATCA
GTTCCACATCAAAACAGGACATGAATCATTGCTGATTGGAACTGGCTGGCAACTCCAGCC
CTGCGATTTCTTTCAATGGTTTCCATCTCACCTTCCTCCAAGTCCCGCACTCTGCGATTA
CTCTGACCCTTGGTTGTAAAGTCGGCAAAAGAGCCAAATACTGCAGCTCCGCTTTTGAAA
GCACCTTTGCCTCTAAGATCCAGAC
■■Homology search results ■■ -
sp_hit_id B1WYX9
Definition sp|B1WYX9|NDHN_CYAA5 NAD(P)H-quinone oxidoreductase subunit N OS=Cyanothece (strain ATCC 51142)
Align length 47
Score (bit) 56.6
E-value 5.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919473|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_E04.
(445 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B1WYX9|NDHN_CYAA5 NAD(P)H-quinone oxidoreductase subunit N OS... 57 5e-08
sp|Q110A6|NDHN_TRIEI NAD(P)H-quinone oxidoreductase subunit N OS... 52 1e-06
sp|Q8YPH8|NDHN_ANASP NAD(P)H-quinone oxidoreductase subunit N OS... 52 1e-06
sp|Q3AUW5|NDHN_SYNS9 NAD(P)H-quinone oxidoreductase subunit N OS... 50 3e-06
sp|Q0ID04|NDHN_SYNS3 NAD(P)H-quinone oxidoreductase subunit N OS... 50 3e-06
sp|Q3MFC2|NDHN_ANAVT NAD(P)H-quinone oxidoreductase subunit N OS... 50 3e-06
sp|B2ITQ6|NDHN_NOSP7 NAD(P)H-quinone oxidoreductase subunit N OS... 49 7e-06
sp|Q5N0W6|NDHN_SYNP6 NAD(P)H-quinone oxidoreductase subunit N OS... 48 2e-05
sp|Q31L05|NDHN_SYNE7 NAD(P)H-quinone oxidoreductase subunit N OS... 48 2e-05
sp|A2C500|NDHN_PROM1 NAD(P)H-quinone oxidoreductase subunit N OS... 48 2e-05
sp|Q7U4K1|NDHN_SYNPX NAD(P)H-quinone oxidoreductase subunit N OS... 47 4e-05
sp|Q7NEV8|NDHN_GLOVI NAD(P)H-quinone oxidoreductase subunit N OS... 47 4e-05
sp|Q46IQ8|NDHN_PROMT NAD(P)H-quinone oxidoreductase subunit N OS... 47 5e-05
sp|A2BYT7|NDHN_PROM5 NAD(P)H-quinone oxidoreductase subunit N OS... 47 5e-05
sp|B1X509|NDHN_PAUCH NAD(P)H-quinone oxidoreductase subunit N, c... 45 1e-04
sp|B0CA85|NDHN_ACAM1 NAD(P)H-quinone oxidoreductase subunit N OS... 45 1e-04
sp|Q8DJU2|NDHN_THEEB NAD(P)H-quinone oxidoreductase subunit N OS... 45 1e-04
sp|A5GIU6|NDHN_SYNPW NAD(P)H-quinone oxidoreductase subunit N OS... 45 1e-04
sp|Q3AMM9|NDHN_SYNSC NAD(P)H-quinone oxidoreductase subunit N OS... 44 2e-04
sp|B0JY52|NDHN_MICAN NAD(P)H-quinone oxidoreductase subunit N OS... 44 2e-04
sp|A5GVV9|NDHN_SYNR3 NAD(P)H-quinone oxidoreductase subunit N OS... 44 3e-04
sp|A2CC26|NDHN_PROM3 NAD(P)H-quinone oxidoreductase subunit N OS... 43 5e-04
sp|Q7V543|NDHN_PROMM NAD(P)H-quinone oxidoreductase subunit N OS... 43 7e-04
sp|A2BTD8|NDHN_PROMS NAD(P)H-quinone oxidoreductase subunit N OS... 42 0.001
sp|Q318I3|NDHN_PROM9 NAD(P)H-quinone oxidoreductase subunit N OS... 42 0.001
sp|A8G763|NDHN_PROM2 NAD(P)H-quinone oxidoreductase subunit N OS... 42 0.001
sp|Q7UZU6|NDHN_PROMP NAD(P)H-quinone oxidoreductase subunit N OS... 42 0.002
sp|P74069|NDHN_SYNY3 NAD(P)H-quinone oxidoreductase subunit N OS... 41 0.002
sp|A9BCP8|NDHN_PROM4 NAD(P)H-quinone oxidoreductase subunit N OS... 41 0.002
sp|B1XK97|NDHN_SYNP2 NAD(P)H-quinone oxidoreductase subunit N OS... 40 0.003

>sp|B1WYX9|NDHN_CYAA5 NAD(P)H-quinone oxidoreductase subunit N
OS=Cyanothece (strain ATCC 51142) GN=ndhN PE=3 SV=1
Length = 158

Score = 56.6 bits (135), Expect = 5e-08
Identities = 24/47 (51%), Positives = 34/47 (72%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEI 305
+WILE +LSKAEL+YL LP +PR++V+ E G R RW+PL+ +
Sbjct: 108 LWILEGYILSKAELEYLVSLPQQEPRIKVVVELGGERYFRWEPLENL 154


>sp|Q110A6|NDHN_TRIEI NAD(P)H-quinone oxidoreductase subunit N
OS=Trichodesmium erythraeum (strain IMS101) GN=ndhN PE=3
SV=1
Length = 158

Score = 52.0 bits (123), Expect = 1e-06
Identities = 22/45 (48%), Positives = 32/45 (71%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLK 311
+WI+E ++LS E++YL +LP +PRV+VI E G R RW PL+
Sbjct: 108 LWIMEGQILSSQEIEYLTVLPKSEPRVKVIVEMGGDRFFRWTPLQ 152


>sp|Q8YPH8|NDHN_ANASP NAD(P)H-quinone oxidoreductase subunit N
OS=Anabaena sp. (strain PCC 7120) GN=ndhN PE=3 SV=1
Length = 162

Score = 52.0 bits (123), Expect = 1e-06
Identities = 22/46 (47%), Positives = 33/46 (71%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKE 308
+WI+E +LS E+++L LP+L+PRV+V+ E G R RWK LK+
Sbjct: 108 LWIIEGHILSDQEVEFLTSLPSLEPRVKVVVERGGDRTFRWKALKD 153


>sp|Q3AUW5|NDHN_SYNS9 NAD(P)H-quinone oxidoreductase subunit N
OS=Synechococcus sp. (strain CC9902) GN=ndhN PE=3 SV=1
Length = 157

Score = 50.4 bits (119), Expect = 3e-06
Identities = 23/49 (46%), Positives = 34/49 (69%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAG 299
+WILE +VLS++EL L L +PR+R+I E G R +RW+P+K + G
Sbjct: 108 LWILEGQVLSRSELLSLCDLCKREPRLRIIVEMGGARSLRWQPMKALLG 156


>sp|Q0ID04|NDHN_SYNS3 NAD(P)H-quinone oxidoreductase subunit N
OS=Synechococcus sp. (strain CC9311) GN=ndhN PE=3 SV=1
Length = 153

Score = 50.4 bits (119), Expect = 3e-06
Identities = 22/47 (46%), Positives = 34/47 (72%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEI 305
+W+LE +VLS++EL L L +PR++V+ E G R +RW+PLKE+
Sbjct: 104 LWLLEGQVLSRSELSALCDLCRREPRLKVVVEMGGARSLRWQPLKEL 150


>sp|Q3MFC2|NDHN_ANAVT NAD(P)H-quinone oxidoreductase subunit N
OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937)
GN=ndhN PE=3 SV=1
Length = 162

Score = 50.4 bits (119), Expect = 3e-06
Identities = 22/46 (47%), Positives = 32/46 (69%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKE 308
+WI+E +LS E+++L LP L+PRV+V+ E G R RWK LK+
Sbjct: 108 LWIIEGHILSDQEVEFLTDLPKLEPRVKVVVERGGDRTFRWKALKD 153


>sp|B2ITQ6|NDHN_NOSP7 NAD(P)H-quinone oxidoreductase subunit N
OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102)
GN=ndhN PE=3 SV=1
Length = 158

Score = 49.3 bits (116), Expect = 7e-06
Identities = 22/46 (47%), Positives = 31/46 (67%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKE 308
+WI+E +LS EL+YL LP L+PRV+V+ E G R RW L++
Sbjct: 108 LWIIEGHILSNEELEYLTNLPQLEPRVKVVIERGGDRAFRWTSLEK 153


>sp|Q5N0W6|NDHN_SYNP6 NAD(P)H-quinone oxidoreductase subunit N
OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 /
SAUG 1402/1) GN=ndhN PE=3 SV=1
Length = 158

Score = 47.8 bits (112), Expect = 2e-05
Identities = 21/48 (43%), Positives = 29/48 (60%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIA 302
+W+LE VLS EL Y LP +PR++V+ E G R W+PL +A
Sbjct: 108 LWLLEGHVLSPQELSYFVTLPQAEPRLKVVIEMGGDRGFSWQPLAAVA 155


>sp|Q31L05|NDHN_SYNE7 NAD(P)H-quinone oxidoreductase subunit N
OS=Synechococcus elongatus (strain PCC 7942) GN=ndhN
PE=3 SV=1
Length = 158

Score = 47.8 bits (112), Expect = 2e-05
Identities = 21/48 (43%), Positives = 29/48 (60%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIA 302
+W+LE VLS EL Y LP +PR++V+ E G R W+PL +A
Sbjct: 108 LWLLEGHVLSPQELSYFVTLPQAEPRLKVVIEMGGDRGFSWQPLAAVA 155


>sp|A2C500|NDHN_PROM1 NAD(P)H-quinone oxidoreductase subunit N
OS=Prochlorococcus marinus (strain NATL1A) GN=ndhN PE=3
SV=1
Length = 154

Score = 47.8 bits (112), Expect = 2e-05
Identities = 19/46 (41%), Positives = 33/46 (71%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKE 308
+W+LE +VLSK+EL ++ L +PR++++ E G R ++W+PL E
Sbjct: 104 LWLLEGQVLSKSELLAISNLCQKEPRIKIVIEMGGARSIKWQPLNE 149


tr_hit_id A9PJX9
Definition tr|A9PJX9|A9PJX9_POPJC Putative uncharacterized protein OS=Populus jackii
Align length 50
Score (bit) 91.3
E-value 2.0e-17
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919473|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_E04.
(445 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9PJX9|A9PJX9_POPJC Putative uncharacterized protein OS=Popul... 91 2e-17
tr|A7NXY2|A7NXY2_VITVI Chromosome chr6 scaffold_3, whole genome ... 90 6e-17
tr|Q5N7I5|Q5N7I5_ORYSJ Putative uncharacterized protein B1065E10... 89 1e-16
tr|Q0JH55|Q0JH55_ORYSJ Os01g0882500 protein (Putative uncharacte... 89 1e-16
tr|A2WXN0|A2WXN0_ORYSI Putative uncharacterized protein OS=Oryza... 89 1e-16
tr|A9RS97|A9RS97_PHYPA Predicted protein (Fragment) OS=Physcomit... 88 2e-16
tr|B4FKX8|B4FKX8_MAIZE NADH dehydrogenase I subunit N OS=Zea may... 87 3e-16
tr|B4FBR9|B4FBR9_MAIZE Putative uncharacterized protein OS=Zea m... 87 3e-16
tr|Q9LVM2|Q9LVM2_ARATH Genomic DNA, chromosome 5, P1 clone:MCK7 ... 85 2e-15
tr|A9SZB8|A9SZB8_PHYPA Predicted protein (Fragment) OS=Physcomit... 63 8e-09
tr|B7JYJ3|B7JYJ3_SYNP8 NADH dehydrogenase I subunit N OS=Synecho... 59 2e-07
tr|B4BV67|B4BV67_9CHRO NADH dehydrogenase I subunit N OS=Cyanoth... 59 2e-07
tr|Q4C9C5|Q4C9C5_CROWT NADH dehydrogenase I subunit N OS=Crocosp... 57 5e-07
tr|B8HUU1|B8HUU1_9CHRO NADH dehydrogenase I subunit N, putative ... 56 1e-06
tr|A3IT03|A3IT03_9CHRO Putative uncharacterized protein OS=Cyano... 54 3e-06
tr|B4WHE4|B4WHE4_9SYNE Putative uncharacterized protein OS=Synec... 54 4e-06
tr|B7KEE5|B7KEE5_9CHRO NADH dehydrogenase I subunit N OS=Cyanoth... 54 5e-06
tr|A3YUM0|A3YUM0_9SYNE Putative uncharacterized protein OS=Synec... 54 5e-06
tr|A0ZG77|A0ZG77_NODSP Putative uncharacterized protein OS=Nodul... 52 1e-05
tr|B5W374|B5W374_SPIMA NADH dehydrogenase I subunit N OS=Arthros... 50 4e-05
tr|B4AYV1|B4AYV1_9CHRO NADH dehydrogenase I subunit N OS=Cyanoth... 50 4e-05
tr|A0YJU5|A0YJU5_9CYAN Putative uncharacterized protein OS=Lyngb... 50 4e-05
tr|Q05ZF7|Q05ZF7_9SYNE NADH dehydrogenase I subunit N OS=Synecho... 49 2e-04
tr|B5IPQ2|B5IPQ2_9CHRO NADH dehydrogenase i subunit n OS=Cyanobi... 48 3e-04
tr|A4CSL3|A4CSL3_SYNPV NADH dehydrogenase I subunit N OS=Synecho... 47 4e-04
tr|B4W4Y9|B4W4Y9_9CYAN Putative uncharacterized protein OS=Micro... 45 0.001
tr|A3Z8X8|A3Z8X8_9SYNE NADH dehydrogenase I subunit N OS=Synecho... 45 0.001
tr|Q05QB2|Q05QB2_9SYNE NADH dehydrogenase I subunit N OS=Synecho... 45 0.002
tr|A8YCS9|A8YCS9_MICAE Genome sequencing data, contig C287 OS=Mi... 44 0.003
tr|B5JG66|B5JG66_9BACT Sodium ion-translocating decarboxylase, b... 33 7.0

>tr|A9PJX9|A9PJX9_POPJC Putative uncharacterized protein OS=Populus
jackii PE=2 SV=1
Length = 231

Score = 91.3 bits (225), Expect = 2e-17
Identities = 42/50 (84%), Positives = 46/50 (92%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGL 296
VWI+EAKVLSKAELQ+LALLPTL+P VRV+AECG WRK WKPLKEIAGL
Sbjct: 177 VWIIEAKVLSKAELQFLALLPTLRPNVRVVAECGNWRKFVWKPLKEIAGL 226


>tr|A7NXY2|A7NXY2_VITVI Chromosome chr6 scaffold_3, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00023910001
PE=4 SV=1
Length = 216

Score = 89.7 bits (221), Expect = 6e-17
Identities = 41/50 (82%), Positives = 46/50 (92%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGL 296
VWI+EAKVLSK+ELQ+LALLPTL+P+VRVIAECG WRK WKPLKEIA L
Sbjct: 161 VWIIEAKVLSKSELQFLALLPTLRPKVRVIAECGNWRKFMWKPLKEIAAL 210


>tr|Q5N7I5|Q5N7I5_ORYSJ Putative uncharacterized protein B1065E10.26
OS=Oryza sativa subsp. japonica GN=B1065E10.26 PE=4 SV=1
Length = 455

Score = 89.0 bits (219), Expect = 1e-16
Identities = 39/51 (76%), Positives = 47/51 (92%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGLE 293
VW++EAKVLSKAELQ+LA+LP ++P+VRVIAECG WRK WKPLK+IAGLE
Sbjct: 398 VWVMEAKVLSKAELQFLAILPDIRPKVRVIAECGNWRKFVWKPLKQIAGLE 448


>tr|Q0JH55|Q0JH55_ORYSJ Os01g0882500 protein (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=Os01g0882500 PE=4 SV=1
Length = 211

Score = 89.0 bits (219), Expect = 1e-16
Identities = 39/51 (76%), Positives = 47/51 (92%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGLE 293
VW++EAKVLSKAELQ+LA+LP ++P+VRVIAECG WRK WKPLK+IAGLE
Sbjct: 154 VWVMEAKVLSKAELQFLAILPDIRPKVRVIAECGNWRKFVWKPLKQIAGLE 204


>tr|A2WXN0|A2WXN0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_04681 PE=4 SV=1
Length = 211

Score = 89.0 bits (219), Expect = 1e-16
Identities = 39/51 (76%), Positives = 47/51 (92%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGLE 293
VW++EAKVLSKAELQ+LA+LP ++P+VRVIAECG WRK WKPLK+IAGLE
Sbjct: 154 VWVMEAKVLSKAELQFLAILPDIRPKVRVIAECGNWRKFVWKPLKQIAGLE 204


>tr|A9RS97|A9RS97_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_118507 PE=4 SV=1
Length = 180

Score = 87.8 bits (216), Expect = 2e-16
Identities = 37/57 (64%), Positives = 48/57 (84%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGLELPASSN 275
+W+LEAKVLSK+ELQ+LALLP ++P V+VIAECGTWR +W+PLK+ AGL P +N
Sbjct: 119 LWVLEAKVLSKSELQFLALLPAIRPNVKVIAECGTWRSFKWRPLKDAAGLPAPQEAN 175


>tr|B4FKX8|B4FKX8_MAIZE NADH dehydrogenase I subunit N OS=Zea mays
PE=2 SV=1
Length = 208

Score = 87.4 bits (215), Expect = 3e-16
Identities = 39/51 (76%), Positives = 46/51 (90%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGLE 293
VWI+EAKVLSKAELQ+LA+LP ++P+VRVIAECG WR WKPLK+IAGLE
Sbjct: 151 VWIIEAKVLSKAELQFLAMLPDIRPKVRVIAECGNWRSFVWKPLKQIAGLE 201


>tr|B4FBR9|B4FBR9_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 272

Score = 87.4 bits (215), Expect = 3e-16
Identities = 39/51 (76%), Positives = 46/51 (90%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGLE 293
VWI+EAKVLSKAELQ+LA+LP ++P+VRVIAECG WR WKPLK+IAGLE
Sbjct: 215 VWIIEAKVLSKAELQFLAMLPDIRPKVRVIAECGNWRSFVWKPLKQIAGLE 265


>tr|Q9LVM2|Q9LVM2_ARATH Genomic DNA, chromosome 5, P1 clone:MCK7
(Putative uncharacterized protein At5g58260)
OS=Arabidopsis thaliana GN=At5g58260 PE=2 SV=1
Length = 209

Score = 84.7 bits (208), Expect = 2e-15
Identities = 39/50 (78%), Positives = 44/50 (88%)
Frame = -1

Query: 445 VWILEAKVLSKAELQYLALLPTLQPRVRVIAECGTWRKVRWKPLKEIAGL 296
VW+LEAKVLSK+ELQ+LALLP+L+P VRVIAECG WRK WKPL EIA L
Sbjct: 156 VWVLEAKVLSKSELQFLALLPSLRPNVRVIAECGNWRKFVWKPLAEIANL 205


>tr|A9SZB8|A9SZB8_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_137855 PE=4 SV=1
Length = 130

Score = 62.8 bits (151), Expect = 8e-09
Identities = 26/35 (74%), Positives = 33/35 (94%)
Frame = -1

Query: 442 WILEAKVLSKAELQYLALLPTLQPRVRVIAECGTW 338
W++EAKVLSK+ELQ+LALLP ++P V+VIAECGTW
Sbjct: 96 WVVEAKVLSKSELQFLALLPAIRPNVKVIAECGTW 130