BP919482
Clone id YMU001_000125_F01
Library
Length 515
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000125_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTTTTTTTTTTTTGACCTTGGCTCTACTCACTTCATTTTCATTGAGCTAGCTACC
AAGCTAGGAATTCATGACTTTGGATGTGGGCTTGCCATCTATTGTGAGATGGTGACAGGC
CAAAGTTCTGTATCCAAAAGCAAAGCATTGTTTATTCACAATTTTCACCGTTGATTCCAC
ACAACAAGGTTGTTGAGAATTGCTTTTTGTGTCACTTCTGAGGTTGCATTGCTTTGGAGA
TTGGATTTCAAAGATGCTCCAAATGAGGTGTGTCATTCTAGTCTTCCATCAAATTGTTTG
GTCACATTGCTTCAACAAGCTTGTTGTAGCATTAAGTACTACTACTAGCAAGATAGCAGA
TAGCAAGGTTGCAGCTCCTTTATTCTTAGTGAGAAAGGCCATTTAGATTCTCATGTGGAC
TCAAGACTGGTAGGTTTATCATCTTGTGTGAGTTGCAAGGAAGCCGTTTGCACCTGATAA
TTTTTGGCAATGTATCATCCACTGCAGCTACTACA
■■Homology search results ■■ -
sp_hit_id P46023
Definition sp|P46023|GR101_LYMST G-protein coupled receptor GRL101 OS=Lymnaea stagnalis
Align length 53
Score (bit) 32.3
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919482|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_F01.
(497 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P46023|GR101_LYMST G-protein coupled receptor GRL101 OS=Lymna... 32 1.2
sp|Q8CHX6|MBTP2_MOUSE Membrane-bound transcription factor site-2... 30 4.7
sp|O43462|MBTP2_HUMAN Membrane-bound transcription factor site-2... 30 8.0
sp|Q0III2|MBTP2_BOVIN Membrane-bound transcription factor site-2... 30 8.0

>sp|P46023|GR101_LYMST G-protein coupled receptor GRL101 OS=Lymnaea
stagnalis PE=2 SV=1
Length = 1115

Score = 32.3 bits (72), Expect = 1.2
Identities = 19/53 (35%), Positives = 25/53 (47%), Gaps = 6/53 (11%)
Frame = -3

Query: 255 THLIW-SIFEIQSPKQCNLRSDTKSNSQQPCC-----VESTVKIVNKQCFAFG 115
TH+ W + F + KQC+ D NS + C V + K N QC AFG
Sbjct: 122 THVKWHNHFCVPRDKQCDFLDDCGDNSDEKICERRECVATEFKCNNSQCVAFG 174


>sp|Q8CHX6|MBTP2_MOUSE Membrane-bound transcription factor site-2
protease OS=Mus musculus GN=Mbtps2 PE=2 SV=1
Length = 515

Score = 30.4 bits (67), Expect = 4.7
Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 2/28 (7%)
Frame = -2

Query: 118 WIQNFGLS--PSHNRWQAHIQSHEFLAW 41
W++N GLS P H RWQ I + F +W
Sbjct: 37 WLENNGLSISPFHIRWQTSIFNRAFYSW 64


>sp|O43462|MBTP2_HUMAN Membrane-bound transcription factor site-2
protease OS=Homo sapiens GN=MBTPS2 PE=1 SV=1
Length = 519

Score = 29.6 bits (65), Expect = 8.0
Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%)
Frame = -2

Query: 118 WIQNFGLS--PSHNRWQAHIQSHEFLAW 41
W++N GLS P H RWQ + + F +W
Sbjct: 37 WLENNGLSISPFHIRWQTAVFNRAFYSW 64


>sp|Q0III2|MBTP2_BOVIN Membrane-bound transcription factor site-2
protease OS=Bos taurus GN=MBTPS2 PE=2 SV=1
Length = 516

Score = 29.6 bits (65), Expect = 8.0
Identities = 12/28 (42%), Positives = 17/28 (60%), Gaps = 2/28 (7%)
Frame = -2

Query: 118 WIQNFGLS--PSHNRWQAHIQSHEFLAW 41
W++N GLS P H RWQ + + F +W
Sbjct: 37 WLENNGLSISPFHIRWQTAVFNRAFYSW 64


tr_hit_id Q234Z0
Definition tr|Q234Z0|Q234Z0_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 80
Score (bit) 39.3
E-value 0.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919482|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_F01.
(497 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q234Z0|Q234Z0_TETTH Putative uncharacterized protein OS=Tetra... 39 0.10
tr|Q234N3|Q234N3_TETTH Putative uncharacterized protein OS=Tetra... 38 0.23
tr|A7Q5G6|A7Q5G6_VITVI Chromosome undetermined scaffold_53, whol... 29 1.4
tr|A5BGE7|A5BGE7_VITVI Putative uncharacterized protein OS=Vitis... 29 1.4
tr|A9RKY8|A9RKY8_PHYPA SNF2 family DNA-dependent ATPase OS=Physc... 28 1.8
tr|Q5JL01|Q5JL01_ORYSJ Putative rad8 (Os01g0952200 protein) OS=O... 28 3.0
tr|B8A980|B8A980_ORYSI Putative uncharacterized protein OS=Oryza... 28 3.0
tr|A3A1K6|A3A1K6_ORYSJ Putative uncharacterized protein OS=Oryza... 28 3.0
tr|Q4P899|Q4P899_USTMA Putative uncharacterized protein OS=Ustil... 33 5.7
tr|A3BMY0|A3BMY0_ORYSJ Putative uncharacterized protein OS=Oryza... 33 9.8
tr|A2YPF5|A2YPF5_ORYSI Putative uncharacterized protein OS=Oryza... 33 9.8

>tr|Q234Z0|Q234Z0_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00095590 PE=4
SV=1
Length = 839

Score = 39.3 bits (90), Expect = 0.10
Identities = 25/80 (31%), Positives = 36/80 (45%), Gaps = 4/80 (5%)
Frame = +1

Query: 217 WRLDFKDAPNEVCHSSLPSNCLVTLLQQACCSIKYYY----*QDSR*QGCSSFILSEKGH 384
++L +D + VC SS+ SNC Q++C YYY +DS Q C +K
Sbjct: 133 YKLMIRDINDNVCTSSVSSNCDQPSAQKSCDCPNYYYQNSSIKDSCDQACDDGSFFKKNG 192

Query: 385 LDSHVDSRLVGLSSCVSCKE 444
D L S C+ C+E
Sbjct: 193 CDCQKGYFLDNTSQCLKCQE 212


>tr|Q234N3|Q234N3_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00102650 PE=4
SV=1
Length = 1073

Score = 38.1 bits (87), Expect = 0.23
Identities = 18/79 (22%), Positives = 41/79 (51%)
Frame = +1

Query: 202 EVALLWRLDFKDAPNEVCHSSLPSNCLVTLLQQACCSIKYYY*QDSR*QGCSSFILSEKG 381
+ L+ + + D+ ++C PS+CL+ + Q C + Y +S GC + ++++
Sbjct: 304 QACLINQGQYYDSSQKIC-GQCPSSCLICMSSQDCSVCQQNYQLNSLNNGCEACLINQGQ 362

Query: 382 HLDSHVDSRLVGLSSCVSC 438
+ DS+ + + L +C+ C
Sbjct: 363 YYDSNTKTCINCLQNCLKC 381


>tr|A7Q5G6|A7Q5G6_VITVI Chromosome undetermined scaffold_53, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00030933001 PE=4 SV=1
Length = 1294

Score = 29.3 bits (64), Expect(2) = 1.4
Identities = 15/29 (51%), Positives = 18/29 (62%)
Frame = -2

Query: 310 YNKLVEAM*PNNLMED*NDTPHLEHL*NP 224
YN+LV + N LM D ND H+E L NP
Sbjct: 891 YNELVVTVRRNILMADWNDPSHVESLLNP 919



Score = 25.4 bits (54), Expect(2) = 1.4
Identities = 10/29 (34%), Positives = 15/29 (51%)
Frame = -3

Query: 222 SPKQCNLRSDTKSNSQQPCCVESTVKIVN 136
+PKQ R T N + CCV +K+ +
Sbjct: 918 NPKQWKFRISTIKNVRLSCCVAGHIKVTD 946


>tr|A5BGE7|A5BGE7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032626 PE=4 SV=1
Length = 1208

Score = 29.3 bits (64), Expect(2) = 1.4
Identities = 15/29 (51%), Positives = 18/29 (62%)
Frame = -2

Query: 310 YNKLVEAM*PNNLMED*NDTPHLEHL*NP 224
YN+LV + N LM D ND H+E L NP
Sbjct: 797 YNELVVTVRRNILMADWNDPSHVESLLNP 825



Score = 25.4 bits (54), Expect(2) = 1.4
Identities = 10/29 (34%), Positives = 15/29 (51%)
Frame = -3

Query: 222 SPKQCNLRSDTKSNSQQPCCVESTVKIVN 136
+PKQ R T N + CCV +K+ +
Sbjct: 824 NPKQWKFRISTIKNVRLSCCVAGHIKVTD 852


>tr|A9RKY8|A9RKY8_PHYPA SNF2 family DNA-dependent ATPase
OS=Physcomitrella patens subsp. patens GN=CHR1501 PE=4
SV=1
Length = 1128

Score = 28.5 bits (62), Expect(2) = 1.8
Identities = 11/27 (40%), Positives = 16/27 (59%)
Frame = -3

Query: 222 SPKQCNLRSDTKSNSQQPCCVESTVKI 142
+PKQ RS T N++ CCV +K+
Sbjct: 798 NPKQWKFRSSTLRNTRLSCCVAGHIKV 824



Score = 25.8 bits (55), Expect(2) = 1.8
Identities = 13/29 (44%), Positives = 17/29 (58%)
Frame = -2

Query: 310 YNKLVEAM*PNNLMED*NDTPHLEHL*NP 224
YN+LV + N L+ D D H+E L NP
Sbjct: 771 YNELVVTVQRNILLADWRDPSHVESLLNP 799


>tr|Q5JL01|Q5JL01_ORYSJ Putative rad8 (Os01g0952200 protein)
OS=Oryza sativa subsp. japonica GN=P0431G06.4 PE=4 SV=1
Length = 1298

Score = 27.7 bits (60), Expect(2) = 3.0
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = -2

Query: 310 YNKLVEAM*PNNLMED*NDTPHLEHL*NP 224
YN+L + N LM D ND H+E L NP
Sbjct: 896 YNELAVTIRRNILMADWNDPSHVESLLNP 924



Score = 25.8 bits (55), Expect(2) = 3.0
Identities = 10/27 (37%), Positives = 15/27 (55%)
Frame = -3

Query: 222 SPKQCNLRSDTKSNSQQPCCVESTVKI 142
+PKQ R+ T N + CCV +K+
Sbjct: 923 NPKQWKFRTTTIKNVRLSCCVAGHIKV 949


>tr|B8A980|B8A980_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_05224 PE=4 SV=1
Length = 1298

Score = 27.7 bits (60), Expect(2) = 3.0
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = -2

Query: 310 YNKLVEAM*PNNLMED*NDTPHLEHL*NP 224
YN+L + N LM D ND H+E L NP
Sbjct: 896 YNELAVTIRRNILMADWNDPSHVESLLNP 924



Score = 25.8 bits (55), Expect(2) = 3.0
Identities = 10/27 (37%), Positives = 15/27 (55%)
Frame = -3

Query: 222 SPKQCNLRSDTKSNSQQPCCVESTVKI 142
+PKQ R+ T N + CCV +K+
Sbjct: 923 NPKQWKFRTTTIKNVRLSCCVAGHIKV 949


>tr|A3A1K6|A3A1K6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_004678 PE=4 SV=1
Length = 1274

Score = 27.7 bits (60), Expect(2) = 3.0
Identities = 14/29 (48%), Positives = 17/29 (58%)
Frame = -2

Query: 310 YNKLVEAM*PNNLMED*NDTPHLEHL*NP 224
YN+L + N LM D ND H+E L NP
Sbjct: 872 YNELAVTIRRNILMADWNDPSHVESLLNP 900



Score = 25.8 bits (55), Expect(2) = 3.0
Identities = 10/27 (37%), Positives = 15/27 (55%)
Frame = -3

Query: 222 SPKQCNLRSDTKSNSQQPCCVESTVKI 142
+PKQ R+ T N + CCV +K+
Sbjct: 899 NPKQWKFRTTTIKNVRLSCCVAGHIKV 925


>tr|Q4P899|Q4P899_USTMA Putative uncharacterized protein OS=Ustilago
maydis GN=UM03664.1 PE=4 SV=1
Length = 642

Score = 33.5 bits (75), Expect = 5.7
Identities = 29/83 (34%), Positives = 38/83 (45%), Gaps = 8/83 (9%)
Frame = +2

Query: 185 LFVSLLRLHCFGDWISKMLQMRCVILVFHQIVWSHCFNKLVVA---LSTTTSKIADSKVA 355
+F SLLRL C D ++ML + +L QIV C LV A L T DSKV+
Sbjct: 261 IFCSLLRLDCIADDETRMLAKQ--LLENRQIVSERCIELLVKAEMDLQTCKDYQDDSKVS 318

Query: 356 A-----PLFLVRKAI*ILMWTQD 409
L V + + I W +D
Sbjct: 319 GLTRDEALEFVERVVDIFAWHKD 341


>tr|A3BMY0|A3BMY0_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_024402 PE=4 SV=1
Length = 1213

Score = 32.7 bits (73), Expect = 9.8
Identities = 29/98 (29%), Positives = 45/98 (45%), Gaps = 1/98 (1%)
Frame = -3

Query: 348 LLSAILLVVVLNATTSLLKQCDQTI*WKTRMTHLIWSIFEIQSPKQCNLRSDTK-SNSQQ 172
LL A+ + +V N + C + R T+LIW I S R DT S +QQ
Sbjct: 602 LLPALGMSIVNNLASGDENNCVEI----HRETNLIWKIIGFTS-----FRGDTTTSEAQQ 652

Query: 171 PCCVESTVKIVNKQCFAFGYRTLACHHLTIDGKPTSKV 58
V+S+VK++ + G +A +L IDG ++
Sbjct: 653 WVLVKSSVKVLQRLTSIGGEIGIALRNLAIDGDTRQEI 690