BP919490
Clone id YMU001_000125_F09
Library
Length 546
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000125_F09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GTTGTATTCCAGCTACCCATGATGGAGTCTCTTGCCACACCACTCTTTGTTTATGCAGCT
CCCTTCCAAAAAATGGCCCATCTCCTTGTTACAGACTCTCTAAAGTCTTGGCCACACAAT
CCCTTCCAACAACTACCCCATCTCCTTGTTACGGACTCCCTAAAGCCTTGCCTAACTTAC
TGCATCTAGATAAAGACTTACCATTTGAGGAGGTTGTTTTCCTCTATGAGTACCAACCAC
TTAAGAGCACCATGCTACCCCATACCAAATCTCTCACCACAAGACTCCTTTCATAGTTCT
TAATGTGGCCATCACCAATATAAAGGATTGTACTTCAGCCCAGTCTTGAAACCTCCCTCA
TTAAATTTTTGATAGCAGCATAGTGGCTTCTTTTCACCTATTTAGTTAGAATATTCCAAA
GATCCCTTTTGCCGTTGTCATCACCCTTGCAATTGTGCATTGAAATACACCTCCAAAGCC
CAAGAATCAAGCTCATCACCTTCGCCTCACTAGAGAAATCTTTGCTCTAAGCCACATGCA
CGGACC
■■Homology search results ■■ -
sp_hit_id P36161
Definition sp|P36161|NU133_YEAST Nucleoporin NUP133 OS=Saccharomyces cerevisiae
Align length 78
Score (bit) 33.1
E-value 0.89
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919490|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_F09.
(546 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P36161|NU133_YEAST Nucleoporin NUP133 OS=Saccharomyces cerevi... 33 0.89
sp|Q9P7X2|ELL1_SCHPO RNA polymerase II elongation factor ell1 OS... 31 3.4
sp|P56961|ARODE_CHLMU Shikimate biosynthesis protein aroDE OS=Ch... 31 4.4
sp|Q870G1|LYS1_EMENI Saccharopine dehydrogenase [NAD+, L-lysine-... 30 5.8
sp|P83474|Y818_DROME Uncharacterized protein CG42266 OS=Drosophi... 30 5.9
sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell leuk... 30 7.6
sp|Q3U0K8|OGFD1_MOUSE 2-oxoglutarate and iron-dependent oxygenas... 30 7.6

>sp|P36161|NU133_YEAST Nucleoporin NUP133 OS=Saccharomyces cerevisiae
GN=NUP133 PE=1 SV=1
Length = 1157

Score = 33.1 bits (74), Expect = 0.89
Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 7/78 (8%)
Frame = -3

Query: 451 CKGDDNGK-RDLWNILTK*VKRSHYAAIKNLMREVSRLG*STILYIG------DGHIKNY 293
CK NG R+++NIL + +K + + +L+ S L L+I DG++ N+
Sbjct: 972 CKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNF 1031

Query: 292 ERSLVVRDLVWGSMVLLS 239
E + LVW +VLL+
Sbjct: 1032 EVKKFLNALVWRRIVLLN 1049


>sp|Q9P7X2|ELL1_SCHPO RNA polymerase II elongation factor ell1
OS=Schizosaccharomyces pombe GN=ell1 PE=1 SV=1
Length = 533

Score = 31.2 bits (69), Expect = 3.4
Identities = 20/53 (37%), Positives = 26/53 (49%)
Frame = +3

Query: 18 HDGVSCHTTLCLCSSLPKNGPSPCYRLSKVLATQSLPTTTPSPCYGLPKALPN 176
+DG S +TT L KNG P + + S PT TPSP LP + P+
Sbjct: 131 NDGGSKNTTARKQKQLKKNGLRPLNTSASRIGLSSSPTNTPSP--NLPVSQPS 181


>sp|P56961|ARODE_CHLMU Shikimate biosynthesis protein aroDE
OS=Chlamydia muridarum GN=aroE PE=3 SV=1
Length = 478

Score = 30.8 bits (68), Expect = 4.4
Identities = 27/93 (29%), Positives = 40/93 (43%), Gaps = 7/93 (7%)
Frame = +3

Query: 105 VLATQSLPTTTPSP----CYGLPKALPNLLHLDKDLPFEEVVFLYEYQP-LKSTMLPHTK 269
VL + P+ TP L K P L LDKD P EE++ + P +K HT
Sbjct: 53 VLTWKKPPSCTPQAWVKKIQSLAKLHPTYLDLDKDFPEEEILHIRHLHPNIKIIRSLHTS 112

Query: 270 SLT--TRLLS*FLMWPSPI*RIVLQPSLETSLI 362
T T+L + L ++ + P+ T L+
Sbjct: 113 EHTDITQLYTQMLASSIDYYKLAVSPASTTDLL 145


>sp|Q870G1|LYS1_EMENI Saccharopine dehydrogenase [NAD+,
L-lysine-forming] OS=Emericella nidulans GN=lysA PE=3
SV=1
Length = 375

Score = 30.4 bits (67), Expect = 5.8
Identities = 14/46 (30%), Positives = 23/46 (50%)
Frame = +3

Query: 72 NGPSPCYRLSKVLATQSLPTTTPSPCYGLPKALPNLLHLDKDLPFE 209
N P P Y ++ ++P T P+ G P ++ ++ HL LP E
Sbjct: 287 NNPIPVYNITTTFDKPTVPVTLPNGTQGTPLSVISIDHLPSLLPRE 332


>sp|P83474|Y818_DROME Uncharacterized protein CG42266 OS=Drosophila
melanogaster GN=CG42266 PE=2 SV=2
Length = 587

Score = 30.4 bits (67), Expect = 5.9
Identities = 10/19 (52%), Positives = 15/19 (78%), Gaps = 1/19 (5%)
Frame = +1

Query: 406 LEYSKDPFCR-CHHPCNCA 459
L+Y + PFC C++PC+CA
Sbjct: 550 LDYGRSPFCNPCYNPCSCA 568


>sp|P03363|POL_HTLV2 Gag-Pro-Pol polyprotein OS=Human T-cell
leukemia virus 2 GN=gag-pro-pol PE=1 SV=4
Length = 1461

Score = 30.0 bits (66), Expect = 7.6
Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 6/56 (10%)
Frame = +3

Query: 111 ATQSLPTTTPSPCYG------LPKALPNLLHLDKDLPFEEVVFLYEYQPLKSTMLP 260
AT ++ TT SP G LP ALP+L +D F ++ +YQP + +P
Sbjct: 646 ATNAITTTLTSPSPGPPDLTSLPTALPHLQTIDLTDAFFQIPLPKQYQPYFAFTIP 701


>sp|Q3U0K8|OGFD1_MOUSE 2-oxoglutarate and iron-dependent oxygenase
domain-containing protein 1 OS=Mus musculus GN=Ogfod1
PE=2 SV=1
Length = 545

Score = 30.0 bits (66), Expect = 7.6
Identities = 17/64 (26%), Positives = 30/64 (46%)
Frame = +3

Query: 177 LLHLDKDLPFEEVVFLYEYQPLKSTMLPHTKSLTTRLLS*FLMWPSPI*RIVLQPSLETS 356
LL LD + ++ + LK+ PH +L + F W S + I L+P+++ S
Sbjct: 83 LLSLDFHEKYNDLYKFQQSDDLKNRKEPHISALRKLMFEDFRAWLSKVSGIDLEPTIDMS 142

Query: 357 LIKF 368
K+
Sbjct: 143 CAKY 146


tr_hit_id Q229X4
Definition tr|Q229X4|Q229X4_TETTH Putative uncharacterized protein (Fragment) OS=Tetrahymena thermophila SB210
Align length 68
Score (bit) 35.8
E-value 1.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919490|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_F09.
(546 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q229X4|Q229X4_TETTH Putative uncharacterized protein (Fragmen... 36 1.5
tr|B6KG21|B6KG21_TOXGO Putative uncharacterized protein OS=Toxop... 36 1.5
tr|Q1DQS9|Q1DQS9_COCIM Putative uncharacterized protein OS=Cocci... 34 4.4
tr|Q4N221|Q4N221_THEPA Putative uncharacterized protein OS=Theil... 34 5.8
tr|B4KUH5|B4KUH5_DROMO GI18378 OS=Drosophila mojavensis GN=GI183... 34 5.8
tr|B8M2A3|B8M2A3_9EURO Putative uncharacterized protein OS=Talar... 34 5.8
tr|Q4QB29|Q4QB29_LEIMA Putative uncharacterized protein OS=Leish... 33 7.6
tr|Q23AU9|Q23AU9_TETTH Putative uncharacterized protein OS=Tetra... 33 7.6
tr|B8PE77|B8PE77_9APHY Predicted protein OS=Postia placenta Mad-... 33 7.6
tr|B3LRF6|B3LRF6_YEAS1 Nucleoporin NUP133 OS=Saccharomyces cerev... 33 9.9
tr|B0E2U4|B0E2U4_LACBS Predicted protein OS=Laccaria bicolor (st... 33 9.9
tr|A7A041|A7A041_YEAS7 Nuclear pore complex subunit OS=Saccharom... 33 9.9
tr|B5IRP5|B5IRP5_9EURY DNA polymerase (Pol2) superfamily OS=Ther... 33 9.9

>tr|Q229X4|Q229X4_TETTH Putative uncharacterized protein (Fragment)
OS=Tetrahymena thermophila SB210 GN=TTHERM_01312370 PE=4
SV=2
Length = 2227

Score = 35.8 bits (81), Expect = 1.5
Identities = 25/68 (36%), Positives = 33/68 (48%), Gaps = 3/68 (4%)
Frame = +3

Query: 3 CIPAT--HDGVSCHTTLCLCS-SLPKNGPSPCYRLSKVLATQSLPTTTPSPCYGLPKALP 173
C+P + + G T LCL S +NG S CY+ L T P T S CY L + P
Sbjct: 1514 CLPLSDKNPGQENLTQLCLKEQSQGQNGASNCYKNGYCLLTD--PVTNKSSCYKLDFSNP 1571

Query: 174 NLLHLDKD 197
N + + KD
Sbjct: 1572 NTIGIQKD 1579


>tr|B6KG21|B6KG21_TOXGO Putative uncharacterized protein OS=Toxoplasma
gondii ME49 GN=TGME49_044130 PE=4 SV=1
Length = 2325

Score = 35.8 bits (81), Expect = 1.5
Identities = 21/66 (31%), Positives = 33/66 (50%)
Frame = -3

Query: 217 TTSSNGKSLSRCSKLGKALGSP*QGDGVVVGRDCVAKTLESL*QGDGPFFGRELHKQRVV 38
++SS+ S S CS G A G P +G +C+ +L L P G L ++ VV
Sbjct: 2213 SSSSSSSSSSSCSSSGAAAGVPGEGQSPSAVAECLLSSLNGL--AGVPRLGGLLGRKGVV 2270

Query: 37 WQETPS 20
W++ P+
Sbjct: 2271 WRQGPN 2276


>tr|Q1DQS9|Q1DQS9_COCIM Putative uncharacterized protein
OS=Coccidioides immitis GN=CIMG_07334 PE=4 SV=1
Length = 241

Score = 34.3 bits (77), Expect = 4.4
Identities = 26/73 (35%), Positives = 33/73 (45%), Gaps = 1/73 (1%)
Frame = +3

Query: 57 SSLPKNGPSPCYRLSKVLATQSLPTTTPSPCYGLPKALPNLLHLDKDLPFEEVVFLYEYQ 236
S+LP P P L ++Q P P Y P P L+LD + F E+ Y
Sbjct: 47 STLPSTDPPP---LPASTSSQQPAVHIPPPSYLDPTTYPQTLYLDPERIFIELT----YH 99

Query: 237 PLK-STMLPHTKS 272
PL ST L HT+S
Sbjct: 100 PLSPSTYLAHTRS 112


>tr|Q4N221|Q4N221_THEPA Putative uncharacterized protein
OS=Theileria parva GN=TP04_0552 PE=3 SV=1
Length = 288

Score = 33.9 bits (76), Expect = 5.8
Identities = 19/51 (37%), Positives = 26/51 (50%)
Frame = +3

Query: 204 FEEVVFLYEYQPLKSTMLPHTKSLTTRLLS*FLMWPSPI*RIVLQPSLETS 356
F + +FLY Y +KS + P SL +R +S L P R Q +L TS
Sbjct: 83 FSQSIFLYTYDNIKSDVTPPVASLISRFISLVLSQPLDCMRTYYQATLYTS 133


>tr|B4KUH5|B4KUH5_DROMO GI18378 OS=Drosophila mojavensis GN=GI18378
PE=4 SV=1
Length = 1674

Score = 33.9 bits (76), Expect = 5.8
Identities = 17/39 (43%), Positives = 21/39 (53%)
Frame = +3

Query: 84 PCYRLSKVLATQSLPTTTPSPCYGLPKALPNLLHLDKDL 200
PC +L A + PT P+ Y LP LPNL+HL L
Sbjct: 418 PCQKLQLAAAAAATPTPNPT-LYQLPVQLPNLVHLPPQL 455


>tr|B8M2A3|B8M2A3_9EURO Putative uncharacterized protein
OS=Talaromyces stipitatus ATCC 10500 GN=TSTA_088030 PE=4
SV=1
Length = 200

Score = 33.9 bits (76), Expect = 5.8
Identities = 28/96 (29%), Positives = 41/96 (42%), Gaps = 5/96 (5%)
Frame = +3

Query: 96 LSKVLATQSLPTTTPSPCYG-----LPKALPNLLHLDKDLPFEEVVFLYEYQPLKSTMLP 260
+S +L T LP +PSP LP +LP H L + +Y P+KST
Sbjct: 78 ISNILTTSILPALSPSPSSSPTSNSLPPSLPPS-HPPSGLEQLTYATITQYTPVKSTPTT 136

Query: 261 HTKSLTTRLLS*FLMWPSPI*RIVLQPSLETSLIKF 368
H+K+ + P P+ L PS +L+ F
Sbjct: 137 HSKAPIKK--------PMPLTGFALCPSSPEALLAF 164


>tr|Q4QB29|Q4QB29_LEIMA Putative uncharacterized protein OS=Leishmania
major GN=LmjF23.1250 PE=4 SV=1
Length = 1352

Score = 33.5 bits (75), Expect = 7.6
Identities = 23/66 (34%), Positives = 30/66 (45%)
Frame = +3

Query: 39 TTLCLCSSLPKNGPSPCYRLSKVLATQSLPTTTPSPCYGLPKALPNLLHLDKDLPFEEVV 218
+T+ SS P PSP + L T+S P P P P LP L +DL EE +
Sbjct: 1279 STIGARSSPPHAEPSPSQLHTTGLNTRSPPFIPPPPMSPPPPPLPEELSPPRDLSMEEEL 1338

Query: 219 FLYEYQ 236
EY+
Sbjct: 1339 LRLEYK 1344


>tr|Q23AU9|Q23AU9_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_01486710 PE=4
SV=1
Length = 2410

Score = 33.5 bits (75), Expect = 7.6
Identities = 24/68 (35%), Positives = 31/68 (45%), Gaps = 3/68 (4%)
Frame = +3

Query: 3 CIPAT--HDGVSCHTTLCLCS-SLPKNGPSPCYRLSKVLATQSLPTTTPSPCYGLPKALP 173
CIP + H G T CL S +NG S CY+ L P T + CY L + P
Sbjct: 1753 CIPLSDSHPGQEKQTQKCLQEQSQGQNGASNCYKNGYCLFKD--PLTDKASCYKLDFSNP 1810

Query: 174 NLLHLDKD 197
N + + KD
Sbjct: 1811 NAIGIQKD 1818


>tr|B8PE77|B8PE77_9APHY Predicted protein OS=Postia placenta
Mad-698-R GN=POSPLDRAFT_92907 PE=4 SV=1
Length = 445

Score = 33.5 bits (75), Expect = 7.6
Identities = 15/52 (28%), Positives = 28/52 (53%)
Frame = +3

Query: 105 VLATQSLPTTTPSPCYGLPKALPNLLHLDKDLPFEEVVFLYEYQPLKSTMLP 260
V A Q + T P Y + + +L+ + + LPF + ++LY + P++ M P
Sbjct: 58 VNARQHVDTVLPHQ-YSIRRDYDSLIGITRSLPFNDTLYLYSFPPIREAMQP 108


>tr|B3LRF6|B3LRF6_YEAS1 Nucleoporin NUP133 OS=Saccharomyces cerevisiae
(strain RM11-1a) GN=SCRG_04097 PE=4 SV=1
Length = 1157

Score = 33.1 bits (74), Expect = 9.9
Identities = 24/78 (30%), Positives = 40/78 (51%), Gaps = 7/78 (8%)
Frame = -3

Query: 451 CKGDDNGK-RDLWNILTK*VKRSHYAAIKNLMREVSRLG*STILYIG------DGHIKNY 293
CK NG R+++NIL + +K + + +L+ S L L+I DG++ N+
Sbjct: 972 CKRFKNGSIREVFNILVEELKSTTVVNLSDLVELYSMLDDEESLFIPLRLLSVDGNLLNF 1031

Query: 292 ERSLVVRDLVWGSMVLLS 239
E + LVW +VLL+
Sbjct: 1032 EVKKFLNALVWRRIVLLN 1049