BP919504
Clone id YMU001_000125_H01
Library
Length 472
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000125_H01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTAGATCCAAAAGCCAAGTCACGTGGCCCAATCTACATCCAGACATAGGAGTT
AGCATTAATGAGATACATAAAAGCAATAGTAAGCTCAGAAACATATTCATTACAACTTCT
ACAGAGTAGCATTCATCTCTACCACAAATGCGCTCAATGCACGTGGAATTTCTCCTCATC
GACATATGTGGTAGTTGCGAATCAAGCTTTGCAAATCCTTTGAGAAAACCATGTAGCTTC
AATCCATTATTCAAAAACCCAACCAATTTCCAGCTCCTCTGCTCTCTCAACCTCTTTCTT
TTCCAATAAGTGGACAGGGGCACGCCATTAATTTCTTTGGTATACAAGACGATCGTATCC
ATACAAAATTGTACCAATAATATCAGTGCATAATGCCTCAAGGCAGTAAGGCACCATAAT
TTACACATAAAGCTCCTACATTGCACAAGTACGTGTTGAGGGCTTTTTGCAG
■■Homology search results ■■ -
sp_hit_id Q9UW24
Definition sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans
Align length 54
Score (bit) 31.6
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919504|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_H01.
(459 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Can... 32 1.7
sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase r... 31 2.9
sp|P06538|DPOL_ADE12 DNA polymerase OS=Human adenovirus A seroty... 30 5.0

>sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a
OS=Candida albicans GN=PIKA PE=3 SV=1
Length = 956

Score = 31.6 bits (70), Expect = 1.7
Identities = 18/54 (33%), Positives = 27/54 (50%)
Frame = +1

Query: 61 SINEIHKSNSKLRNIFITTSTE*HSSLPQMRSMHVEFLLIDICGSCESSFANPL 222
S + K +KL+NI T H P+ R L++ CGS S+F++PL
Sbjct: 109 SFQTVRKFINKLQNILFNVETSFHIRGPEFRENMQPALIL--CGSVASAFSSPL 160


>sp|Q54M77|ROCO8_DICDI Probable serine/threonine-protein kinase roco8
OS=Dictyostelium discoideum GN=roco8 PE=3 SV=1
Length = 1867

Score = 30.8 bits (68), Expect = 2.9
Identities = 21/96 (21%), Positives = 46/96 (47%), Gaps = 6/96 (6%)
Frame = -2

Query: 431 FMCKLWCLTALRHYALILLVQFCMDTIVLYTKEINGVPLSTYWKRKR-----LREQRSWK 267
F ++W ++ L H ++L+ FC + + + ++ LS++ K+K+ L Q K
Sbjct: 1639 FRREVWLMSGLSHSNIVLMKGFCFEPYAIVMEYMDIGSLSSFLKKKKEDGQVLDWQMLLK 1698

Query: 266 LVGFLNNGLK-LHGFLKGFAKLDSQLPHMSMRRNST 162
+V + +G+ LH D + P++ + + T
Sbjct: 1699 IVTDIASGMAFLHNITPPLVHRDLKSPNILLASHPT 1734


>sp|P06538|DPOL_ADE12 DNA polymerase OS=Human adenovirus A serotype
12 GN=POL PE=3 SV=2
Length = 1061

Score = 30.0 bits (66), Expect = 5.0
Identities = 16/37 (43%), Positives = 17/37 (45%), Gaps = 2/37 (5%)
Frame = -2

Query: 344 YTKEINGVPLSTYWKRKR--LREQRSWKLVGFLNNGL 240
Y + NG PL YWK K L Q WK G N L
Sbjct: 401 YRADANGFPLEEYWKDKEEYLLNQELWKKKGEKNYNL 437


tr_hit_id A6RT71
Definition tr|A6RT71|A6RT71_BOTFB Putative uncharacterized protein OS=Botryotinia fuckeliana (strain B05.10)
Align length 78
Score (bit) 33.5
E-value 5.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919504|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_H01.
(459 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A6RT71|A6RT71_BOTFB Putative uncharacterized protein OS=Botry... 33 5.4
tr|B0EQE3|B0EQE3_ENTDI F-box/leucine rich repeat protein, putati... 33 9.2
tr|B2VJ53|B2VJ53_ERWT9 Putative multidrug resistance proteins OS... 33 9.2
tr|Q6H5V3|Q6H5V3_ORYSJ Os02g0638400 protein OS=Oryza sativa subs... 33 9.2
tr|Q0JR11|Q0JR11_ORYSJ Os01g0127400 protein (Putative uncharacte... 33 9.2
tr|A3A9E8|A3A9E8_ORYSJ Putative uncharacterized protein OS=Oryza... 33 9.2

>tr|A6RT71|A6RT71_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_03807
PE=4 SV=1
Length = 1007

Score = 33.5 bits (75), Expect = 5.4
Identities = 20/78 (25%), Positives = 38/78 (48%), Gaps = 6/78 (7%)
Frame = +1

Query: 61 SINEIHKSNSKLRNIFITTSTE*HSSLPQMRSMHVEFLLIDICGSCES------SFANPL 222
+++ +H +S R + TT + SS Q + F+L++ CG CE+ +FA P+
Sbjct: 66 AVHSLHPDSSSQRRLSATTDSRNDSSTAQDQLKAKGFILVEWCGKCEADKVSMGTFAVPV 125

Query: 223 RKPCSFNPLFKNPTNFQL 276
+ +F N + Q+
Sbjct: 126 GHGGMYGLVFDNTFSKQI 143


>tr|B0EQE3|B0EQE3_ENTDI F-box/leucine rich repeat protein, putative
OS=Entamoeba dispar SAW760 GN=EDI_122050 PE=4 SV=1
Length = 427

Score = 32.7 bits (73), Expect = 9.2
Identities = 21/86 (24%), Positives = 37/86 (43%), Gaps = 2/86 (2%)
Frame = +1

Query: 46 PDIGVSINEIHKSNSKLRNIFITTSTE*HSSL--PQMRSMHVEFLLIDICGSCESSFANP 219
P +G + KL+ + I+ + E S+ ++++H+E L I C E SF +
Sbjct: 191 PKVGSKTIQQFNHFKKLKKLIISDNDELTDSILKKNLKNIHLEHLTISDCSGLEGSFISD 250

Query: 220 LRKPCSFNPLFKNPTNFQLLCSLNLF 297
L F + + LCS N +
Sbjct: 251 LPPLKKLTLTFNKSLDNKCLCSYNYY 276


>tr|B2VJ53|B2VJ53_ERWT9 Putative multidrug resistance proteins
OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99)
GN=ETA_15460 PE=4 SV=1
Length = 396

Score = 32.7 bits (73), Expect = 9.2
Identities = 15/50 (30%), Positives = 24/50 (48%)
Frame = -2

Query: 452 VLVQCRSFMCKLWCLTALRHYALILLVQFCMDTIVLYTKEINGVPLSTYW 303
VL + W L A + L+ F +T L T+++ G+PL+ YW
Sbjct: 149 VLADAFGWRANFWFLAAYAVFIAALIALFLPETRPLDTQKVKGLPLAQYW 198


>tr|Q6H5V3|Q6H5V3_ORYSJ Os02g0638400 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0014E22.29 PE=2 SV=1
Length = 353

Score = 32.7 bits (73), Expect = 9.2
Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 11/112 (9%)
Frame = -2

Query: 455 HVLVQCRSFMCKLWCLTALRHYAL-----------ILLVQFCMDTIVLYTKEINGVPLST 309
H+L++ F + A HYA+ I +QF ++ IV K + G P S
Sbjct: 234 HILLKAALFNAE-----ASYHYAIELHEKTEIGEEIARLQFGINAIVDAKKAVRGAPGSL 288

Query: 308 YWKRKRLREQRSWKLVGFLNNGLKLHGFLKGFAKLDSQLPHMSMRRNSTCIE 153
Y RL + + L LN +++ AKL + LP S+ R+++ E
Sbjct: 289 YDAASRLEQDMNQNLERALNENNRIYLLRVPAAKLLAPLPAASLVRSASLSE 340


>tr|Q0JR11|Q0JR11_ORYSJ Os01g0127400 protein (Putative
uncharacterized protein) OS=Oryza sativa subsp. japonica
GN=Os01g0127400 PE=4 SV=1
Length = 547

Score = 32.7 bits (73), Expect = 9.2
Identities = 22/73 (30%), Positives = 38/73 (52%), Gaps = 2/73 (2%)
Frame = -2

Query: 398 RHYALILLVQFCMDTIVLYTKEINGVPLSTYWKRKRLREQRSWKLVGFLNNGLKLHGFLK 219
R YA +LVQ D +++Y ++G PL + +++LV N+G + G+LK
Sbjct: 287 RAYASTVLVQLAPDLLLIYCSFLSGAPLEI-----SISRMLTYQLVWVKNSGKIVFGYLK 341

Query: 218 GFAKLDSQL--PH 186
F K ++ + PH
Sbjct: 342 -FQKFEAGIWNPH 353


>tr|A3A9E8|A3A9E8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_007420 PE=4 SV=1
Length = 798

Score = 32.7 bits (73), Expect = 9.2
Identities = 30/112 (26%), Positives = 49/112 (43%), Gaps = 11/112 (9%)
Frame = -2

Query: 455 HVLVQCRSFMCKLWCLTALRHYAL-----------ILLVQFCMDTIVLYTKEINGVPLST 309
H+L++ F + A HYA+ I +QF ++ IV K + G P S
Sbjct: 679 HILLKAALFNAE-----ASYHYAIELHEKTEIGEEIARLQFGINAIVDAKKAVRGAPGSL 733

Query: 308 YWKRKRLREQRSWKLVGFLNNGLKLHGFLKGFAKLDSQLPHMSMRRNSTCIE 153
Y RL + + L LN +++ AKL + LP S+ R+++ E
Sbjct: 734 YDAASRLEQDMNQNLERALNENNRIYLLRVPAAKLLAPLPAASLVRSASLSE 785