BP919507
Clone id YMU001_000125_H04
Library
Length 430
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000125_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATTCGCGGCCGCGAATTCTTCCAGTTATCGAAATCTCACCATTGCCCAATACTATCACTT
CACATCAGCCTTACTGTAATCGCCGCAATCCTTTGCCGCTCTCTTAGCAGACTGGCATCC
TCATGGATAAAGGAAACTGTGCCATGAACATCACCATCAAATGCTGCAGAATTGACATGG
GTGTCTACTACAATCCAGGCCACATCTTCAATGCGACTTGTGGACCATACCCGAGGCTCG
TCAGAGTACTCAATCATCTTACAACTTTCGCAGTTCCTGATAGTATCTGATCAACCAAGG
CTTCTGGTAGGCTTCCCTTGGACTGAAAATGCCTCATGTGAAGTATCGGCTCACAACCAA
GATCAGCAACAGAAATGCCGGAAATATCGTTCGTGTTGAACCTCTTTGCTTGTTGCAAGT
TGAGAGAATG
■■Homology search results ■■ -
sp_hit_id Q3SYW2
Definition sp|Q3SYW2|CO2_BOVIN Complement C2 OS=Bos taurus
Align length 60
Score (bit) 30.0
E-value 3.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919507|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_H04.
(404 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3SYW2|CO2_BOVIN Complement C2 OS=Bos taurus GN=C2 PE=2 SV=1 30 3.7
sp|P49048|GPI8_CAEEL Putative GPI-anchor transamidase OS=Caenorh... 30 4.8
sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex to... 29 6.3
sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex qu... 29 6.3
sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex pi... 29 6.3
sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=AC... 29 6.3
sp|Q9RXL3|MURE_DEIRA UDP-N-acetylmuramyl-tripeptide synthetase O... 29 8.2
sp|P31468|CBRB_ECOLI Inner membrane protein cbrB OS=Escherichia ... 29 8.2

>sp|Q3SYW2|CO2_BOVIN Complement C2 OS=Bos taurus GN=C2 PE=2 SV=1
Length = 750

Score = 30.0 bits (66), Expect = 3.7
Identities = 18/60 (30%), Positives = 27/60 (45%), Gaps = 4/60 (6%)
Frame = +1

Query: 109 NCAMNITIKCCRIDMGVYYNPGHIFNATCG----PYPRLVRVLNHLTTFAVPDSI*STKA 276
+C N+ I + +NPG I +C PYP + R+ + +P S STKA
Sbjct: 23 SCPKNVNISGGSFTLSNGWNPGSILTYSCPLGHYPYPVVTRLCKSNGQWQIPRSTRSTKA 82


>sp|P49048|GPI8_CAEEL Putative GPI-anchor transamidase
OS=Caenorhabditis elegans GN=T05E11.6 PE=1 SV=3
Length = 319

Score = 29.6 bits (65), Expect = 4.8
Identities = 19/60 (31%), Positives = 27/60 (45%), Gaps = 3/60 (5%)
Frame = -3

Query: 249 NCESCKMIEYSDEPRVWSTSRI---EDVAWIVVDTHVNSAAFDGDVHGTVSFIHEDASLL 79
+C S M E+ D P V S S E+ VDT + D H TV+F+ ++ L
Sbjct: 197 SCRSASMYEWIDSPNVLSLSSSLTHEESYSYDVDTDIGVYVIDRYTHYTVNFLTKEVKAL 256


>sp|Q86GC9|ACES_CULTO Acetylcholinesterase (Fragment) OS=Culex
torrentium GN=ACE-1 PE=3 SV=1
Length = 132

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
Frame = +2

Query: 98 WIKETVP*TSPSNAAELTWV--STTIQATSSMRLVDHTRGSSEYSIILQLSQFLIVS 262
+I VP P NAA + W+ T+++ + DH +SE ++I+ Q+ + S
Sbjct: 74 YINVVVPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRTLASEENVIVVSLQYRVAS 130


>sp|Q867X2|ACES_CULQU Acetylcholinesterase (Fragment) OS=Culex
quinquefasciatus GN=ACE-1 PE=3 SV=1
Length = 132

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
Frame = +2

Query: 98 WIKETVP*TSPSNAAELTWV--STTIQATSSMRLVDHTRGSSEYSIILQLSQFLIVS 262
+I VP P NAA + W+ T+++ + DH +SE ++I+ Q+ + S
Sbjct: 74 YINVVVPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRTLASEENVIVVSLQYRVAS 130


>sp|Q867X3|ACES_CULPP Acetylcholinesterase (Fragment) OS=Culex
pipiens pipiens GN=ACE-1 PE=3 SV=1
Length = 132

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
Frame = +2

Query: 98 WIKETVP*TSPSNAAELTWV--STTIQATSSMRLVDHTRGSSEYSIILQLSQFLIVS 262
+I VP P NAA + W+ T+++ + DH +SE ++I+ Q+ + S
Sbjct: 74 YINVVVPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRTLASEENVIVVSLQYRVAS 130


>sp|Q86GC8|ACES_CULPI Acetylcholinesterase OS=Culex pipiens GN=ACHE1
PE=2 SV=2
Length = 702

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/57 (28%), Positives = 29/57 (50%), Gaps = 2/57 (3%)
Frame = +2

Query: 98 WIKETVP*TSPSNAAELTWV--STTIQATSSMRLVDHTRGSSEYSIILQLSQFLIVS 262
+I VP P NAA + W+ T+++ + DH +SE ++I+ Q+ + S
Sbjct: 224 YINVVVPRPRPKNAAVMLWIFGGGFYSGTATLDVYDHRTLASEENVIVVSLQYRVAS 280


>sp|Q9RXL3|MURE_DEIRA UDP-N-acetylmuramyl-tripeptide synthetase
OS=Deinococcus radiodurans GN=murE PE=3 SV=1
Length = 490

Score = 28.9 bits (63), Expect = 8.2
Identities = 19/52 (36%), Positives = 25/52 (48%), Gaps = 1/52 (1%)
Frame = -3

Query: 198 STSRIEDVAW-IVVDTHVNSAAFDGDVHGTVSFIHEDASLLRERQRIAAITV 46
S R+ V W + V TH++S D HGT+ D L ER R A + V
Sbjct: 190 SLDRVRGVDWDVAVWTHLSSEHLD--FHGTLDNYFADKRKLVERARFAVLNV 239


>sp|P31468|CBRB_ECOLI Inner membrane protein cbrB OS=Escherichia
coli (strain K12) GN=cbrB PE=1 SV=1
Length = 155

Score = 28.9 bits (63), Expect = 8.2
Identities = 18/58 (31%), Positives = 28/58 (48%)
Frame = -1

Query: 389 QQAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQILSGTAKVVR*LSTL 216
Q+ R I G+ + ++ C I+H+ KG L + ILSG + VVR + L
Sbjct: 76 QKRYRCLAGGIGGVVITEIYCAVIVHI-----KGMASSELFENILSGDSLVVRIIPAL 128


tr_hit_id Q9FGS4|Q9FGS4_ARATH Gb
Definition tr|Q9FGS4|Q9FGS4_ARATH Gb|AAF26953.1 (Putative uncharacterized protein At5g50210) (Putative uncharacterized protein) OS=Arabidopsis thaliana
Align length 48
Score (bit) 56.2
E-value 8.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919507|Adiantum capillus-veneris mRNA, clone:
YMU001_000125_H04.
(404 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q9FGS4|Q9FGS4_ARATH Gb|AAF26953.1 (Putative uncharacterized p... 56 8e-07
tr|A7PCQ2|A7PCQ2_VITVI Chromosome chr17 scaffold_12, whole genom... 55 1e-06
tr|Q2QTL0|Q2QTL0_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 55 2e-06
tr|Q2QTK9|Q2QTK9_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 55 2e-06
tr|A3CGJ6|A3CGJ6_ORYSJ Putative uncharacterized protein OS=Oryza... 53 7e-06
tr|A4S9B2|A4S9B2_OSTLU Predicted protein OS=Ostreococcus lucimar... 47 4e-04
tr|Q00T95|Q00T95_OSTTA Homology to unknown gene OS=Ostreococcus ... 45 0.002
tr|B8BP70|B8BP70_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A9RPD6|A9RPD6_PHYPA Predicted protein (Fragment) OS=Physcomit... 40 0.045
tr|A9SEY5|A9SEY5_PHYPA Predicted protein OS=Physcomitrella paten... 40 0.077
tr|A6GBP5|A6GBP5_9DELT Quinolinate synthetase complex, A subunit... 38 0.22
tr|Q0VMQ7|Q0VMQ7_ALCBS Peptide synthetase, putative OS=Alcanivor... 34 3.2
tr|B3U1Y9|B3U1Y9_9MARC Pentatricopeptide repeat protein (Fragmen... 34 3.2
tr|B3U1K7|B3U1K7_9MARC Pentatricopeptide repeat protein (Fragmen... 34 3.2
tr|B3U1X9|B3U1X9_9MARC Pentatricopeptide repeat protein (Fragmen... 33 9.4

>tr|Q9FGS4|Q9FGS4_ARATH Gb|AAF26953.1 (Putative uncharacterized
protein At5g50210) (Putative uncharacterized protein)
OS=Arabidopsis thaliana GN=At5g50210 PE=2 SV=1
Length = 718

Score = 56.2 bits (134), Expect = 8e-07
Identities = 26/48 (54%), Positives = 33/48 (68%)
Frame = -1

Query: 383 AKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQILSGTAK 240
A+RF G +AD+GCEPILHMRHFQ+ LP+ LV Q+LS +K
Sbjct: 670 AERFKRQTPQGKLIADVGCEPILHMRHFQANKELPDKLVHQVLSCESK 717


>tr|A7PCQ2|A7PCQ2_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015962001
PE=4 SV=1
Length = 742

Score = 55.5 bits (132), Expect = 1e-06
Identities = 26/44 (59%), Positives = 33/44 (75%)
Frame = -1

Query: 386 QAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQIL 255
+A RF+ +G S+AD+GCEPIL+MRHFQ+ LPE LV QIL
Sbjct: 687 EAGRFHLQTPNGNSIADVGCEPILNMRHFQATKELPEKLVSQIL 730


>tr|Q2QTL0|Q2QTL0_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os12g19304 PE=4 SV=1
Length = 475

Score = 54.7 bits (130), Expect = 2e-06
Identities = 25/46 (54%), Positives = 31/46 (67%)
Frame = -1

Query: 386 QAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQILSG 249
QA RFN G VA++GCEPILHMRHFQ+ LP+ LV ++ G
Sbjct: 424 QASRFNAKTPLGKLVAEVGCEPILHMRHFQATKRLPDKLVHHVIHG 469


>tr|Q2QTK9|Q2QTK9_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=LOC_Os12g19304 PE=4 SV=1
Length = 413

Score = 54.7 bits (130), Expect = 2e-06
Identities = 25/46 (54%), Positives = 31/46 (67%)
Frame = -1

Query: 386 QAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQILSG 249
QA RFN G VA++GCEPILHMRHFQ+ LP+ LV ++ G
Sbjct: 362 QASRFNAKTPLGKLVAEVGCEPILHMRHFQATKRLPDKLVHHVIHG 407


>tr|A3CGJ6|A3CGJ6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_034418 PE=4 SV=1
Length = 752

Score = 53.1 bits (126), Expect = 7e-06
Identities = 25/47 (53%), Positives = 31/47 (65%)
Frame = -1

Query: 386 QAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQILSGT 246
QA RFN G VA++GCEPILHMRHFQ+ LP+ LV ++ T
Sbjct: 664 QASRFNAKTPLGKLVAEVGCEPILHMRHFQATKRLPDKLVHHVIHVT 710


>tr|A4S9B2|A4S9B2_OSTLU Predicted protein OS=Ostreococcus
lucimarinus (strain CCE9901) GN=OSTLU_28143 PE=4 SV=1
Length = 579

Score = 47.4 bits (111), Expect = 4e-04
Identities = 21/47 (44%), Positives = 31/47 (65%)
Frame = -1

Query: 398 LNLQQAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQI 258
L Q+ +++ + D +G S+A GC PILHMRHFQ + +ALV+ I
Sbjct: 530 LAAQEPRKYESADGAGPSIASQGCVPILHMRHFQKNKTFSDALVEDI 576


>tr|Q00T95|Q00T95_OSTTA Homology to unknown gene OS=Ostreococcus
tauri GN=Ot17g01940 PE=4 SV=1
Length = 622

Score = 45.1 bits (105), Expect = 0.002
Identities = 20/47 (42%), Positives = 29/47 (61%)
Frame = -1

Query: 398 LNLQQAKRFNTNDISGISVADLGCEPILHMRHFQSKGSLPEALVDQI 258
L Q+ +++ + D +G S+A GC PILHMRHFQ + + LV I
Sbjct: 572 LAAQEPRKYESEDGTGPSIASQGCVPILHMRHFQKNKTFSDELVTDI 618


>tr|B8BP70|B8BP70_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_38036 PE=4 SV=1
Length = 676

Score = 44.7 bits (104), Expect = 0.002
Identities = 20/30 (66%), Positives = 22/30 (73%)
Frame = -1

Query: 386 QAKRFNTNDISGISVADLGCEPILHMRHFQ 297
QA RFN G VA++GCEPILHMRHFQ
Sbjct: 646 QASRFNAKTPLGKLVAEVGCEPILHMRHFQ 675


>tr|A9RPD6|A9RPD6_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_117327 PE=4 SV=1
Length = 638

Score = 40.4 bits (93), Expect = 0.045
Identities = 18/27 (66%), Positives = 20/27 (74%)
Frame = -1

Query: 377 RFNTNDISGISVADLGCEPILHMRHFQ 297
R T I G ++ DLGCEPILHMRHFQ
Sbjct: 588 RTYTTLIDGQTLGDLGCEPILHMRHFQ 614


>tr|A9SEY5|A9SEY5_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_128647 PE=4 SV=1
Length = 668

Score = 39.7 bits (91), Expect = 0.077
Identities = 16/21 (76%), Positives = 18/21 (85%)
Frame = -1

Query: 359 ISGISVADLGCEPILHMRHFQ 297
I G ++ DLGCEPILHMRHFQ
Sbjct: 642 IDGQALGDLGCEPILHMRHFQ 662