BP919514
Clone id YMU001_000126_A02
Library
Length 559
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000126_A02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTACACGCCAAAAAGGTCCGAATTTTCTTCGCTCCACAGCTTGAGTCCTTTTCTCGCCTT
TACATTCTAAGATTGCTCTGCAAATTTTCCATTCTGTTGGTTGGGCTTTTGTGATCCTTC
GTTCTAGGTCCATTTTCTGTTGGTTGGGTCTTCTGCTTGCGTTAAAGCTTGTGGGTTCTT
GTGCTTTGTTGAGGTTGTCCATTGTGCCCATGACTTAAGTTCTCTGTTGCTTAAATCCTT
CCAGTTGGTCGGAAAAATTTGTCTTTTTTGTGATAACCATGCGCCGGAAGTGCATAAATC
AAAGAGTATAACTTCATTGTTCGCGTAGGTGTCTGTGAGAAGTGAGTTTCTTCTCTTCAC
CACTGGATTTGACTCATCTCTGGCAAAAGCCTTCAAGTATAGTGGCAATCATTCTCTGTT
TTTCATCAGTACATTTTGTATTTTGTGAGCCATGTAATCATCAGTGCACTGCTGCCTTTT
GTTGAGCGTACCATGGATTTGCTGTTTTTCTCTTCAATGTGGTATACTCGTTATGATTGT
GTCAGCAATCAAAGCCATG
■■Homology search results ■■ -
sp_hit_id B0G163
Definition sp|B0G163|EXOC5_DICDI Exocyst complex component 5 OS=Dictyostelium discoideum
Align length 63
Score (bit) 32.7
E-value 1.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919514|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_A02.
(544 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|B0G163|EXOC5_DICDI Exocyst complex component 5 OS=Dictyosteli... 33 1.2
sp|Q8NWQ6|EBH_STAAW Extracellular matrix-binding protein ebh OS=... 32 2.6
sp|A5ISW6|EBH_STAA9 Extracellular matrix-binding protein ebh OS=... 32 2.6
sp|A6U1Q5|EBH_STAA2 Extracellular matrix-binding protein ebh OS=... 32 2.6
sp|Q99U54|EBHA_STAAN Extracellular matrix-binding protein ebhA O... 32 2.6
sp|Q931R6|EBHA_STAAM Extracellular matrix-binding protein ebhA O... 32 2.6
sp|A7X2C3|EBHA_STAA1 Extracellular matrix-binding protein ebhA O... 32 2.6
sp|A8Z414|EBH_STAAT Extracellular matrix-binding protein ebh OS=... 31 3.4
sp|Q6GGX3|EBH_STAAR Extracellular matrix-binding protein ebh OS=... 31 3.4
sp|Q5HFY8|EBH_STAAC Extracellular matrix-binding protein ebh OS=... 31 3.4
sp|Q2FYJ6|EBH_STAA8 Extracellular matrix-binding protein ebh OS=... 31 3.4
sp|Q2FH04|EBH_STAA3 Extracellular matrix-binding protein ebh OS=... 31 3.4
sp|A6QGY4|EBHA_STAAE Extracellular matrix-binding protein ebhA O... 31 3.4
sp|P70434|IRF7_MOUSE Interferon regulatory factor 7 OS=Mus muscu... 30 5.8
sp|Q7NF75|SYI_GLOVI Isoleucyl-tRNA synthetase OS=Gloeobacter vio... 30 7.6
sp|Q8HWS3|RFX6_HUMAN DNA-binding protein RFX6 OS=Homo sapiens GN... 30 7.6
sp|Q54GU4|Y6505_DICDI Uncharacterized protein DDB_G0289975 OS=Di... 30 9.9
sp|A2C071|SYI_PROM1 Isoleucyl-tRNA synthetase OS=Prochlorococcus... 30 9.9
sp|O93308|SMC1A_XENLA Structural maintenance of chromosomes prot... 30 9.9
sp|Q9Z1M9|SMC1A_RAT Structural maintenance of chromosomes protei... 30 9.9
sp|Q9CU62|SMC1A_MOUSE Structural maintenance of chromosomes prot... 30 9.9
sp|Q14683|SMC1A_HUMAN Structural maintenance of chromosomes prot... 30 9.9
sp|O97593|SMC1A_BOVIN Structural maintenance of chromosomes prot... 30 9.9

>sp|B0G163|EXOC5_DICDI Exocyst complex component 5 OS=Dictyostelium
discoideum GN=exoc5 PE=3 SV=1
Length = 978

Score = 32.7 bits (73), Expect = 1.2
Identities = 19/63 (30%), Positives = 29/63 (46%), Gaps = 6/63 (9%)
Frame = -1

Query: 298 SYTL*FMHFRRM------VITKKTNFSDQLEGFKQQRT*VMGTMDNLNKAQEPTSFNASR 137
SY F HF+++ + TK +F D+L+ QQ+ G + +N E S AS
Sbjct: 343 SYQECFQHFKKLEKGVNTIGTKAVHFGDELDSVNQQKVKAQGALSLINYLLELNSVGASS 402

Query: 136 RPN 128
N
Sbjct: 403 EEN 405


>sp|Q8NWQ6|EBH_STAAW Extracellular matrix-binding protein ebh
OS=Staphylococcus aureus (strain MW2) GN=ebh PE=1 SV=1
Length = 9904

Score = 31.6 bits (70), Expect = 2.6
Identities = 14/28 (50%), Positives = 20/28 (71%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQE 161
N ++ LE KQQ T +G++DNLN AQ+
Sbjct: 6487 NSNENLEAAKQQATQSLGSLDNLNNAQK 6514


>sp|A5ISW6|EBH_STAA9 Extracellular matrix-binding protein ebh
OS=Staphylococcus aureus (strain JH9) GN=ebh PE=4 SV=1
Length = 10624

Score = 31.6 bits (70), Expect = 2.6
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPTSFN 146
N ++ LE KQQ T +G++DNLN AQ+ N
Sbjct: 7130 NGNENLEAAKQQATQSLGSLDNLNNAQKQAVTN 7162


>sp|A6U1Q5|EBH_STAA2 Extracellular matrix-binding protein ebh
OS=Staphylococcus aureus (strain JH1) GN=ebh PE=4 SV=1
Length = 10624

Score = 31.6 bits (70), Expect = 2.6
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPTSFN 146
N ++ LE KQQ T +G++DNLN AQ+ N
Sbjct: 7130 NGNENLEAAKQQATQSLGSLDNLNNAQKQAVTN 7162


>sp|Q99U54|EBHA_STAAN Extracellular matrix-binding protein ebhA
OS=Staphylococcus aureus (strain N315) GN=ebhA PE=4 SV=1
Length = 6713

Score = 31.6 bits (70), Expect = 2.6
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPTSFN 146
N ++ LE KQQ T +G++DNLN AQ+ N
Sbjct: 3219 NGNENLEAAKQQATQSLGSLDNLNNAQKQAVTN 3251


>sp|Q931R6|EBHA_STAAM Extracellular matrix-binding protein ebhA
OS=Staphylococcus aureus (strain Mu50 / ATCC 700699)
GN=ebhA PE=1 SV=1
Length = 6713

Score = 31.6 bits (70), Expect = 2.6
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPTSFN 146
N ++ LE KQQ T +G++DNLN AQ+ N
Sbjct: 3219 NGNENLEAAKQQATQSLGSLDNLNNAQKQAVTN 3251


>sp|A7X2C3|EBHA_STAA1 Extracellular matrix-binding protein ebhA
OS=Staphylococcus aureus (strain Mu3 / ATCC 700698)
GN=ebhA PE=4 SV=1
Length = 6713

Score = 31.6 bits (70), Expect = 2.6
Identities = 15/33 (45%), Positives = 21/33 (63%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPTSFN 146
N ++ LE KQQ T +G++DNLN AQ+ N
Sbjct: 3219 NGNENLEAAKQQATQSLGSLDNLNNAQKQAVTN 3251


>sp|A8Z414|EBH_STAAT Extracellular matrix-binding protein ebh
OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=ebh
PE=4 SV=1
Length = 10421

Score = 31.2 bits (69), Expect = 3.4
Identities = 14/30 (46%), Positives = 21/30 (70%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPT 155
N ++ LE KQQ + +G++DNLN AQ+ T
Sbjct: 7130 NGNENLEAAKQQASQSLGSLDNLNNAQKQT 7159


>sp|Q6GGX3|EBH_STAAR Extracellular matrix-binding protein ebh
OS=Staphylococcus aureus (strain MRSA252) GN=ebh PE=4
SV=1
Length = 10746

Score = 31.2 bits (69), Expect = 3.4
Identities = 14/28 (50%), Positives = 20/28 (71%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQE 161
N ++ LE KQQ T +G++DNLN AQ+
Sbjct: 7126 NGNENLEAAKQQATQSLGSLDNLNNAQK 7153


>sp|Q5HFY8|EBH_STAAC Extracellular matrix-binding protein ebh
OS=Staphylococcus aureus (strain COL) GN=ebh PE=4 SV=1
Length = 10498

Score = 31.2 bits (69), Expect = 3.4
Identities = 14/30 (46%), Positives = 21/30 (70%)
Frame = -1

Query: 244 NFSDQLEGFKQQRT*VMGTMDNLNKAQEPT 155
N ++ LE KQQ + +G++DNLN AQ+ T
Sbjct: 7130 NGNENLEAAKQQASQSLGSLDNLNNAQKQT 7159


tr_hit_id Q22TC4
Definition tr|Q22TC4|Q22TC4_TETTH Putative uncharacterized protein OS=Tetrahymena thermophila SB210
Align length 117
Score (bit) 34.3
E-value 4.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919514|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_A02.
(544 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q22TC4|Q22TC4_TETTH Putative uncharacterized protein OS=Tetra... 34 4.4
tr|Q23CW2|Q23CW2_TETTH EF hand family protein OS=Tetrahymena the... 34 5.8
tr|Q5A6R0|Q5A6R0_CANAL Putative uncharacterized protein NAF1 OS=... 34 5.8
tr|Q965S5|Q965S5_CAEEL Synaptotagmin protein 3 OS=Caenorhabditis... 30 6.5
tr|Q5A708|Q5A708_CANAL Putative uncharacterized protein NAF1 OS=... 33 7.6
tr|Q6MT43|Q6MT43_MYCMS Prolipoprotein OS=Mycoplasma mycoides sub... 33 9.7
tr|Q1NHZ3|Q1NHZ3_9SPHN TonB-dependent receptor OS=Sphingomonas s... 33 9.9

>tr|Q22TC4|Q22TC4_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00180920 PE=4
SV=1
Length = 1258

Score = 34.3 bits (77), Expect = 4.4
Identities = 29/117 (24%), Positives = 52/117 (44%), Gaps = 15/117 (12%)
Frame = +2

Query: 134 SSACVKACGFLCFVEVVHCAHDLSSLLLKSFQLVGKICL--FCDNHAPEV--HKSKSITS 301
++AC+ C C ++++ D S+ K+ K CL D+ E+ H + I
Sbjct: 1097 TNACLAIC--YCIKQIINSNLDRKSIFEKTM----KFCLTHIMDSQIIEILQHSTNPIMK 1150

Query: 302 LFA*VSVRSEFLLFTT-----------GFDSSLAKAFKYSGNHSLFFISTFCIL*AM 439
+F ++++ + L F GF+SSL F Y G+ LF C++ A+
Sbjct: 1151 VFDHLTIQQQPLQFAVYMAFYFFYHNFGFESSLQNIFSYGGDSCLFGSIVGCLIGAI 1207


>tr|Q23CW2|Q23CW2_TETTH EF hand family protein OS=Tetrahymena
thermophila SB210 GN=TTHERM_00052280 PE=4 SV=1
Length = 6110

Score = 33.9 bits (76), Expect = 5.8
Identities = 20/61 (32%), Positives = 31/61 (50%)
Frame = -1

Query: 190 TMDNLNKAQEPTSFNASRRPNQQKMDLERRITKAQPTEWKICRAILECKGEKRTQAVERR 11
T+ LN A T+F S+ QQK D E ++ Q E K + E KG+ + + +R+
Sbjct: 3612 TLSELNNALADTAFYKSKSQQQQKKDQEEQVLSLQ--ERKDAAKLEEIKGQIKIKLTQRQ 3669

Query: 10 K 8
K
Sbjct: 3670 K 3670


>tr|Q5A6R0|Q5A6R0_CANAL Putative uncharacterized protein NAF1
OS=Candida albicans GN=NAF1 PE=4 SV=1
Length = 612

Score = 33.9 bits (76), Expect = 5.8
Identities = 23/91 (25%), Positives = 40/91 (43%)
Frame = -1

Query: 349 SGEEKKLTSHRHLREQ*SYTL*FMHFRRMVITKKTNFSDQLEGFKQQRT*VMGTMDNLNK 170
SG+EK T +R L +Q ++ +FS E QQ T + +++
Sbjct: 5 SGKEKNKTQNRDLIKQ------------QLLYSDCSFSKMSESTNQQETALREIVEDTTN 52

Query: 169 AQEPTSFNASRRPNQQKMDLERRITKAQPTE 77
A EPT+ + + PN+ + E T+ +E
Sbjct: 53 ANEPTAIDKTTLPNETSHERETTTTENASSE 83


>tr|Q965S5|Q965S5_CAEEL Synaptotagmin protein 3 OS=Caenorhabditis
elegans GN=snt-3 PE=2 SV=2
Length = 452

Score = 30.0 bits (66), Expect(2) = 6.5
Identities = 30/117 (25%), Positives = 48/117 (41%), Gaps = 7/117 (5%)
Frame = -2

Query: 390 PLYLKAFARDESNPVVKRRNSLLT----DTYANNEVI---LFDLCTSGAWLSQKRQIFPT 232
P Y ++F+ D ++ ++R + +T D +NE I + C +G L Q
Sbjct: 208 PYYNESFSFDVTSEKMQRVHLHVTVSDYDRVGSNERIGQVIIGTCATGVALKQ------- 260

Query: 231 NWKDLSNRELKSWAQWTTSTKHKNPQALTQAEDPTNRKWT*NEGSQKPNQQNGKFAE 61
W D+ +S AQW T +N L T +T N S+ N N + E
Sbjct: 261 -WNDMLATPRRSVAQWHTLHAMENLIVLFCVGTATGNHFTFNAPSEISNANNWEHEE 316



Score = 22.7 bits (47), Expect(2) = 6.5
Identities = 8/12 (66%), Positives = 10/12 (83%)
Frame = -1

Query: 508 TTLKRKTANPWY 473
TT+K KT NP+Y
Sbjct: 199 TTIKMKTLNPYY 210


>tr|Q5A708|Q5A708_CANAL Putative uncharacterized protein NAF1
OS=Candida albicans GN=NAF1 PE=4 SV=1
Length = 612

Score = 33.5 bits (75), Expect = 7.6
Identities = 22/91 (24%), Positives = 39/91 (42%)
Frame = -1

Query: 349 SGEEKKLTSHRHLREQ*SYTL*FMHFRRMVITKKTNFSDQLEGFKQQRT*VMGTMDNLNK 170
SG+EK T +R L + ++ +FS E QQ T + +++
Sbjct: 5 SGKEKNKTRNRDL------------IKHQLLYSNCSFSKMSESTNQQETALREIVEDTTN 52

Query: 169 AQEPTSFNASRRPNQQKMDLERRITKAQPTE 77
A EPT+ + + PN+ + E T+ +E
Sbjct: 53 ANEPTAIDKTTLPNETSHERETTTTENASSE 83


>tr|Q6MT43|Q6MT43_MYCMS Prolipoprotein OS=Mycoplasma mycoides subsp.
mycoides SC GN=lpp PE=4 SV=1
Length = 224

Score = 33.1 bits (74), Expect = 9.7
Identities = 15/45 (33%), Positives = 21/45 (46%)
Frame = -3

Query: 215 ATENLSHGHNGQPQQSTRTHKL*RKQKTQPTENGPRTKDHKSPTN 81
A +N++ P + RT K T+P EN P+ D K P N
Sbjct: 23 ACKNINKSKKEDPSKPDRTPKTPENDSTKPEENQPKKPDDKKPNN 67


>tr|Q1NHZ3|Q1NHZ3_9SPHN TonB-dependent receptor OS=Sphingomonas sp.
SKA58 GN=SKA58_00625 PE=3 SV=1
Length = 968

Score = 33.1 bits (74), Expect = 9.9
Identities = 14/52 (26%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
Frame = -2

Query: 369 ARDESNPVVKRRNSLLTDTYANNEVILFDLCTSGAWLSQKRQIFPTN--WKD 220
+R+ S+P+ + +++DT+A+ LF + +G+W +K + N W+D
Sbjct: 177 SRNNSDPITPELSGIISDTFADG---LFGIAVTGSWQKRKASVNQANVGWRD 225