BP919550
Clone id YMU001_000126_D06
Library
Length 366
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000126_D06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GGCCGCACTCCTGCCCAAACCCAAGGCTTGTTGATATAGAAGACCACAAGCTAACCTGAT
CATAGCCACCACATGCTCTAACTTGAAAAGAGAGCTGAACAAGGTCCACCTCTTTCCCTT
TAACGAGAACAGGAATTGGTCTAGTCTCAACTAAGTGCCGAACCTCAAAGGCCTCAATGA
CAGTCTTTATAAGGTCATCCTCCTGAATGTCCATCTCCTCAGGTAACTCGTCTGCTTGAG
TAAGATTACCTGCTAAAAGGCCACCATCCCCTTCTTCAGTCTTGTCACCTGTCATTTCTA
CATCCTTGCCCTCCACAGGGACTGTCATTTGATTGTCATTCGTATCCCCTCCTACTTGTT
GACAAA
■■Homology search results ■■ -
sp_hit_id Q1LKN9
Definition sp|Q1LKN9|UVRC_RALME UvrABC system protein C OS=Ralstonia metallidurans (strain CH34 / ATCC 43123 / DSM 2839)
Align length 77
Score (bit) 32.7
E-value 0.58
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919550|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_D06.
(366 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q1LKN9|UVRC_RALME UvrABC system protein C OS=Ralstonia metall... 33 0.58
sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium d... 32 0.76
sp|Q9WY15|SYL_THEMA Leucyl-tRNA synthetase OS=Thermotoga maritim... 32 1.3
sp|Q12772|SRBP2_HUMAN Sterol regulatory element-binding protein ... 31 2.2
sp|Q18PD9|DOK7_FUGRU Protein Dok-7 OS=Fugu rubripes GN=dok7 PE=2... 31 2.2
sp|P32829|MRE11_YEAST Double-strand break repair protein MRE11 O... 30 3.8
sp|Q60429|SRBP2_CRIGR Sterol regulatory element-binding protein ... 29 6.4
sp|Q6RJR6|RTN3_RAT Reticulon-3 OS=Rattus norvegicus GN=Rtn3 PE=1... 29 6.4
sp|P56931|E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus G... 29 8.3
sp|O30561|THS1_HALVO Thermosome subunit 1 OS=Halobacterium volca... 29 8.4
sp|Q3T1I5|SRBP2_RAT Sterol regulatory element-binding protein 2 ... 29 8.4

>sp|Q1LKN9|UVRC_RALME UvrABC system protein C OS=Ralstonia
metallidurans (strain CH34 / ATCC 43123 / DSM 2839)
GN=uvrC PE=3 SV=1
Length = 673

Score = 32.7 bits (73), Expect = 0.58
Identities = 20/77 (25%), Positives = 34/77 (44%)
Frame = -3

Query: 352 GGDTNDNQMTVPVEGKDVEMTGDKTEEGDGGLLAGNLTQADELPEEMDIQEDDLIKTVIE 173
GG ++ P + M ++ +E DG G D+LP D + V+
Sbjct: 297 GGRHLGDKAYFPAHVDEAAMIVEEGDEADGSAHEGAAADTDQLP------IDRIAARVLS 350

Query: 172 AFEVRHLVETRPIPVLV 122
AF V+H ++ P P++V
Sbjct: 351 AFMVQHYLDQAPPPIVV 367


>sp|Q54NB6|FKBP4_DICDI FK506-binding protein 4 OS=Dictyostelium
discoideum GN=fkbp4 PE=1 SV=1
Length = 364

Score = 32.3 bits (72), Expect = 0.76
Identities = 20/59 (33%), Positives = 30/59 (50%)
Frame = -3

Query: 349 GDTNDNQMTVPVEGKDVEMTGDKTEEGDGGLLAGNLTQADELPEEMDIQEDDLIKTVIE 173
G+ DN+ EG+D EM G+ +E + + + DE EE D +EDD I +E
Sbjct: 100 GEDEDNEEEEGEEGEDEEMEGEDEDEDE-----EDEDEEDEDEEEEDDEEDDEINKELE 153


>sp|Q9WY15|SYL_THEMA Leucyl-tRNA synthetase OS=Thermotoga maritima
GN=leuS PE=3 SV=1
Length = 824

Score = 31.6 bits (70), Expect = 1.3
Identities = 17/47 (36%), Positives = 30/47 (63%), Gaps = 2/47 (4%)
Frame = -3

Query: 232 DELPEEMDIQEDDLIKTVIEAFEVRHLVETRPIP--VLVKGKEVDLV 98
D++ +DI E+DL + V+E V+ V+ +PI + VKG+ V++V
Sbjct: 777 DKVVVPVDISEEDLKRIVLERERVKEYVDGKPIRKFIYVKGRIVNIV 823


>sp|Q12772|SRBP2_HUMAN Sterol regulatory element-binding protein 2
OS=Homo sapiens GN=SREBF2 PE=1 SV=2
Length = 1141

Score = 30.8 bits (68), Expect = 2.2
Identities = 19/83 (22%), Positives = 36/83 (43%)
Frame = -3

Query: 274 EGDGGLLAGNLTQADELPEEMDIQEDDLIKTVIEAFEVRHLVETRPIPVLVKGKEVDLVQ 95
+GD + + T+ + +P+ +++ E L+K + A H +P G++
Sbjct: 889 QGDDAAVRSHFTKVERIPKALEVTESPLVKAIFHACRAMH----ASLPGKADGQQSSFCH 944

Query: 94 LSFQVRACGGYDQVSLWSSISTS 26
RA G LWSS++ S
Sbjct: 945 CE---RASG-----HLWSSLNVS 959


>sp|Q18PD9|DOK7_FUGRU Protein Dok-7 OS=Fugu rubripes GN=dok7 PE=2
SV=1
Length = 502

Score = 30.8 bits (68), Expect = 2.2
Identities = 15/35 (42%), Positives = 18/35 (51%)
Frame = -3

Query: 361 QQVGGDTNDNQMTVPVEGKDVEMTGDKTEEGDGGL 257
Q+VGGDT DNQ + GDK G+G L
Sbjct: 417 QEVGGDTKDNQPPAALGPTTEPAEGDKRSPGEGHL 451


>sp|P32829|MRE11_YEAST Double-strand break repair protein MRE11
OS=Saccharomyces cerevisiae GN=MRE11 PE=1 SV=2
Length = 692

Score = 30.0 bits (66), Expect = 3.8
Identities = 15/43 (34%), Positives = 20/43 (46%)
Frame = -3

Query: 349 GDTNDNQMTVPVEGKDVEMTGDKTEEGDGGLLAGNLTQADELP 221
GD ND Q V ++ D+ M E+ GLL G T+ P
Sbjct: 617 GDNNDAQDDVDIDENDIIMVSTDEEDASYGLLNGRKTKTKTRP 659


>sp|Q60429|SRBP2_CRIGR Sterol regulatory element-binding protein 2
OS=Cricetulus griseus GN=SREBF2 PE=2 SV=1
Length = 1139

Score = 29.3 bits (64), Expect = 6.4
Identities = 10/40 (25%), Positives = 21/40 (52%)
Frame = -3

Query: 274 EGDGGLLAGNLTQADELPEEMDIQEDDLIKTVIEAFEVRH 155
+GD + + T+ + +P+ +++ E L+K V A H
Sbjct: 887 QGDDAAVRSHFTEVERIPKALEVTESPLVKAVFYACRAMH 926


>sp|Q6RJR6|RTN3_RAT Reticulon-3 OS=Rattus norvegicus GN=Rtn3 PE=1
SV=1
Length = 940

Score = 29.3 bits (64), Expect = 6.4
Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 3/75 (4%)
Frame = -3

Query: 328 MTVPVEGKDVEMTGDKTEEGDGGL---LAGNLTQADELPEEMDIQEDDLIKTVIEAFEVR 158
+TVP K + G E+ DG L LT +E +D ++ D+++ V+E ++
Sbjct: 553 LTVPASAKSESLLGKNVEDTDGSSPEDLMAALTGTEE-KGTVDKEKGDVLEAVLE--KIA 609

Query: 157 HLVETRPIPVLVKGK 113
++ T P+ +L + K
Sbjct: 610 NVKNTLPVELLHENK 624


>sp|P56931|E2F2_MOUSE Transcription factor E2F2 OS=Mus musculus
GN=E2f2 PE=1 SV=2
Length = 443

Score = 28.9 bits (63), Expect = 8.3
Identities = 15/36 (41%), Positives = 19/36 (52%)
Frame = +1

Query: 199 PPECPSPQVTRLLE*DYLLKGHHPLLQSCHLSFLHP 306
PP P+P + L D +L+ HPLLQ FL P
Sbjct: 363 PPLPPAPSLVPLEATDNMLELSHPLLQQTEDQFLSP 398


>sp|O30561|THS1_HALVO Thermosome subunit 1 OS=Halobacterium volcanii
GN=cct1 PE=2 SV=1
Length = 560

Score = 28.9 bits (63), Expect = 8.4
Identities = 33/128 (25%), Positives = 52/128 (40%), Gaps = 16/128 (12%)
Frame = -3

Query: 337 DNQMTVPVEGKDVEMTGDKTEEGDGGLLAG-NLTQADELPEEMDIQEDDLIKTVIEAFEV 161
D M VE ++ + D E + + A N+T D+L + +D +E L + V + EV
Sbjct: 225 DENMPYAVEDANIAILDDALEVRETEIDAEVNVTDPDQLQQFLDQEEKQLKEMVDQLVEV 284

Query: 160 ---------------RHLVETRPIPVLVKGKEVDLVQLSFQVRACGGYDQVSLWSSISTS 26
+H + I + + K DL +L+ RA GG SL +
Sbjct: 285 GADAVFVGDGIDDMAQHYLAKEGILAVRRAKSSDLKRLA---RATGGRVVSSLDDIEADD 341

Query: 25 LGFGQECG 2
LGF G
Sbjct: 342 LGFAGSVG 349


tr_hit_id A9TW59
Definition tr|A9TW59|A9TW59_PHYPA ARID/BRIGHT DNA-binding domain-containing protein OS=Physcomitrella patens subsp. patens
Align length 111
Score (bit) 54.7
E-value 2.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919550|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_D06.
(366 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9TW59|A9TW59_PHYPA ARID/BRIGHT DNA-binding domain-containing... 55 2e-06
tr|A9RMF8|A9RMF8_PHYPA ARID/BRIGHT DNA-binding domain-containing... 54 4e-06
tr|B7F182|B7F182_ORYSJ cDNA clone:002-142-B09, full insert seque... 38 0.29
tr|A3R6T2|A3R6T2_PLAFA Erythrocyte membrane protein 1 (Fragment)... 36 0.84
tr|Q7XXA3|Q7XXA3_ORYSJ Os04g0166400 protein OS=Oryza sativa subs... 36 1.1
tr|Q01HC2|Q01HC2_ORYSA OSIGBa0136O08-OSIGBa0153H12.2 protein OS=... 36 1.1
tr|A2XQA2|A2XQA2_ORYSI Putative uncharacterized protein OS=Oryza... 36 1.1
tr|Q0H0R7|Q0H0R7_9PEZI Polyketide synthase OS=Ophiostoma piceae ... 36 1.1
tr|B6KXH7|B6KXH7_BRAFL Putative uncharacterized protein OS=Branc... 35 1.4
tr|A3C582|A3C582_ORYSJ Putative uncharacterized protein OS=Oryza... 35 1.9
tr|A7QNL5|A7QNL5_VITVI Chromosome chr2 scaffold_132, whole genom... 34 3.2
tr|A8Q8K3|A8Q8K3_MALGO Putative uncharacterized protein OS=Malas... 34 3.2
tr|Q8ZYZ9|Q8ZYZ9_PYRAE PaREP1 OS=Pyrobaculum aerophilum GN=PAE05... 34 3.2
tr|A3Z525|A3Z525_9SYNE Putative uncharacterized protein OS=Synec... 34 4.2
tr|Q9LDD4|Q9LDD4_ARATH Putative uncharacterized protein AT4g1140... 34 4.2
tr|Q1PEA0|Q1PEA0_ARATH ARID/BRIGHT DNA-binding domain-containing... 34 4.2
tr|B0EM67|B0EM67_ENTDI Putative uncharacterized protein OS=Entam... 34 4.2
tr|A5K9R5|A5K9R5_PLAVI Bromodomain protein, putative OS=Plasmodi... 34 4.2
tr|A9L2Q3|A9L2Q3_SHEB9 Putative uncharacterized protein OS=Shewa... 33 5.5
tr|A6WJU0|A6WJU0_SHEB8 Putative uncharacterized protein OS=Shewa... 33 5.5
tr|A3D825|A3D825_SHEB5 Putative uncharacterized protein OS=Shewa... 33 5.5
tr|A7EC25|A7EC25_SCLS1 Putative uncharacterized protein OS=Scler... 33 7.1
tr|B5S413|B5S413_RALSO Putative uncharacterized protein OS=Ralst... 33 9.3
tr|Q711Q1|Q711Q1_OSTOS Heat shock protein 20 OS=Ostertagia oster... 33 9.3
tr|B0EKD1|B0EKD1_ENTDI Putative uncharacterized protein OS=Entam... 33 9.3

>tr|A9TW59|A9TW59_PHYPA ARID/BRIGHT DNA-binding domain-containing
protein OS=Physcomitrella patens subsp. patens
GN=ARID1506 PE=4 SV=1
Length = 982

Score = 54.7 bits (130), Expect = 2e-06
Identities = 39/111 (35%), Positives = 55/111 (49%), Gaps = 9/111 (8%)
Frame = -3

Query: 307 KDVEMTGDKTEEGDGGLLAGNLTQADELPE-EMDIQEDD-----LIKTVIEAFEVRHLVE 146
K+VE E GG LT +++ E D ED L+ T E R
Sbjct: 13 KEVEAEESGEVELGGGEKRSKLTASEDFDVGESDEDEDSRMGVLLLNTASRILEARR--R 70

Query: 145 TRPIPVLVKGKEVDLVQLSFQVRACGGYDQVS---LWSSISTSLGFGQECG 2
TRP+PVL+ K VDL+ L +V + GGY +V+ LW ++S +L G +CG
Sbjct: 71 TRPLPVLMGDKAVDLLALHSRVSSMGGYSKVTEAGLWGAVSDALELGLDCG 121


>tr|A9RMF8|A9RMF8_PHYPA ARID/BRIGHT DNA-binding domain-containing
protein OS=Physcomitrella patens subsp. patens
GN=ARID1505 PE=4 SV=1
Length = 844

Score = 53.9 bits (128), Expect = 4e-06
Identities = 41/119 (34%), Positives = 57/119 (47%), Gaps = 4/119 (3%)
Frame = -3

Query: 346 DTNDNQMTVPVEGK-DVEMTGDKTEEGDGGLLAGNLTQADELPEEMDIQEDDLIKTVIEA 170
D + + V VE +VE G + L+ + DE +E L+ TV
Sbjct: 7 DMKNKRKEVEVEDAGEVESGGAEKRSKPNALIELGGRERDE--DETSSSGGSLLNTVQRI 64

Query: 169 FEVRHLVETRPIPVLVKGKEVDLVQLSFQVRACGGYDQVS---LWSSISTSLGFGQECG 2
E R RP+PVL+ K VDL L +V + GGY +V+ +WS IS +LG G ECG
Sbjct: 65 LEARK--RFRPLPVLMGDKVVDLSALHSRVNSMGGYSKVTEAGMWSVISDALGLGLECG 121


>tr|B7F182|B7F182_ORYSJ cDNA clone:002-142-B09, full insert sequence
OS=Oryza sativa subsp. japonica PE=2 SV=1
Length = 289

Score = 37.7 bits (86), Expect = 0.29
Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 5/86 (5%)
Frame = -3

Query: 262 GLLAGNLTQADELPEEMDIQEDDLIKTVIEAFEVRH----LVETRPIPVLV-KGKEVDLV 98
G LAG + LPE+ + ++ + ++ +F + ++ RP+P L+ G V L+
Sbjct: 73 GYLAGQELPSITLPED---RAPEVFERLLGSFLAQSHGPGVLPPRPMPPLLGDGTPVGLL 129

Query: 97 QLSFQVRACGGYDQVSLWSSISTSLG 20
+L VRACGG++ V W++ + G
Sbjct: 130 RLYLAVRACGGFEAVRSWAAAAEMAG 155


>tr|A3R6T2|A3R6T2_PLAFA Erythrocyte membrane protein 1 (Fragment)
OS=Plasmodium falciparum GN=IT4_var30 PE=4 SV=1
Length = 1135

Score = 36.2 bits (82), Expect = 0.84
Identities = 21/63 (33%), Positives = 34/63 (53%), Gaps = 2/63 (3%)
Frame = -3

Query: 325 TVPVEGKDVEMTGDKTEEGDGGLLAGNL--TQADELPEEMDIQEDDLIKTVIEAFEVRHL 152
T P E +D E ++ +E + G G T A+ LP+E ++ E+ + KT + EV +
Sbjct: 675 TAPTEEEDEEEEEEEEDEDEDGDEVGGEEETAAEALPDETEVVEETVAKTTTPSVEVCKI 734

Query: 151 VET 143
VET
Sbjct: 735 VET 737


>tr|Q7XXA3|Q7XXA3_ORYSJ Os04g0166400 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0019G23.13 PE=2 SV=2
Length = 538

Score = 35.8 bits (81), Expect = 1.1
Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 9/67 (13%)
Frame = -3

Query: 196 DLIKTVIEAFEVRHLV----ETRPIPV-LVKGKEVDLVQLSFQVRACGGYDQVS----LW 44
DL TV+ AF +R + E RP+P L G VDL++L +RA GGY S +W
Sbjct: 36 DLFDTVLAAF-LREVYPGGREVRPLPAKLGDGSRVDLLRLFSAIRAAGGYAATSSSPAVW 94

Query: 43 SSISTSL 23
+S + S+
Sbjct: 95 ASAAESV 101


>tr|Q01HC2|Q01HC2_ORYSA OSIGBa0136O08-OSIGBa0153H12.2 protein
OS=Oryza sativa GN=OSIGBa0136O08-OSIGBa0153H12.2 PE=4
SV=1
Length = 538

Score = 35.8 bits (81), Expect = 1.1
Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 9/67 (13%)
Frame = -3

Query: 196 DLIKTVIEAFEVRHLV----ETRPIPV-LVKGKEVDLVQLSFQVRACGGYDQVS----LW 44
DL TV+ AF +R + E RP+P L G VDL++L +RA GGY S +W
Sbjct: 36 DLFDTVLAAF-LREVYPGGREVRPLPAKLGDGSRVDLLRLFSAIRAAGGYAATSSSPAVW 94

Query: 43 SSISTSL 23
+S + S+
Sbjct: 95 ASAAESV 101


>tr|A2XQA2|A2XQA2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_14810 PE=4 SV=1
Length = 538

Score = 35.8 bits (81), Expect = 1.1
Identities = 26/67 (38%), Positives = 37/67 (55%), Gaps = 9/67 (13%)
Frame = -3

Query: 196 DLIKTVIEAFEVRHLV----ETRPIPV-LVKGKEVDLVQLSFQVRACGGYDQVS----LW 44
DL TV+ AF +R + E RP+P L G VDL++L +RA GGY S +W
Sbjct: 36 DLFDTVLAAF-LREVYPGGREVRPLPAKLGDGSRVDLLRLFSAIRAAGGYAATSSSPAVW 94

Query: 43 SSISTSL 23
+S + S+
Sbjct: 95 ASAAESV 101


>tr|Q0H0R7|Q0H0R7_9PEZI Polyketide synthase OS=Ophiostoma piceae
GN=TOPA45 PE=4 SV=2
Length = 2180

Score = 35.8 bits (81), Expect = 1.1
Identities = 18/57 (31%), Positives = 28/57 (49%)
Frame = -3

Query: 358 QVGGDTNDNQMTVPVEGKDVEMTGDKTEEGDGGLLAGNLTQADELPEEMDIQEDDLI 188
+ G +D+ +T P+E D D E GGL A LT + EEM + D+++
Sbjct: 1757 ETDGMKSDSAVTTPMEESDTGSIKDGGEVSAGGLTAHQLTVRTTIAEEMQVDVDEIV 1813


>tr|B6KXH7|B6KXH7_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_63599 PE=4 SV=1
Length = 580

Score = 35.4 bits (80), Expect = 1.4
Identities = 28/72 (38%), Positives = 40/72 (55%), Gaps = 2/72 (2%)
Frame = -3

Query: 319 PVEGKDVEMTGDKTE--EGDGGLLAGNLTQADELPEEMDIQEDDLIKTVIEAFEVRHLVE 146
P+EG E GD+ E E D + +G+ + +E +EMD +ED+ IK V E+ +L E
Sbjct: 435 PMEGAMEEEEGDEEEDSEEDEEMSSGDGEEEEE-NDEMDEEEDEFIKPVPES----NLAE 489

Query: 145 TRPIPVLVKGKE 110
I V VK KE
Sbjct: 490 LGTISVNVKAKE 501


>tr|A3C582|A3C582_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030454 PE=4 SV=1
Length = 305

Score = 35.0 bits (79), Expect = 1.9
Identities = 17/42 (40%), Positives = 26/42 (61%), Gaps = 1/42 (2%)
Frame = -3

Query: 142 RPIPVLV-KGKEVDLVQLSFQVRACGGYDQVSLWSSISTSLG 20
RP+P L+ G V L++L VRACGG++ V W++ + G
Sbjct: 115 RPMPPLLGDGTPVGLLRLYLAVRACGGFEAVRSWAAAAEMAG 156