BP919553
Clone id YMU001_000126_D09
Library
Length 479
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000126_D09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGTTCTTCTTATCCTCTTAAATTCCTGCTCAGTCCAATCATCCTACTTCTGCAGATTAT
TTCAGTAGCGACCTATCAAGAGCCATTCATCCTCATATAGTTCCTCTGCAAAGGACTCAA
GTGAAGACACAAAACATGCATGACTACTCTTTGAATGATCAATAGTGTAAAACTTTGTGC
CAAAATCATCTCCCTCAATAATCATGTCCTGTTCATCTTCATACATTGCCCTAGATAGCA
TATCTGCCATTGGATTGTCTTTCCCTGCAATATGCTTGAACTCAGGATTCAAGGACTTTA
TGTAGGCTATCCATTACATCATTGCAATATCAGGAGTCAAACAGTTTGTGATCATTCCAA
GAAGAGGCAAACAATTAGTTTCCACAACCACTGATGCCCCTTTCAAGTACTCCTTGTCAC
ACCTCAAAGCTATAACCACCCCCCATAGTACCCTTTTTACTTGTGCATAATCACGTTGG
■■Homology search results ■■ -
sp_hit_id P04323
Definition sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster
Align length 86
Score (bit) 38.1
E-value 0.021
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919553|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_D09.
(479 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from tra... 38 0.021
sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from tra... 37 0.035
sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein OS=Sa... 35 0.18
sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein OS=Sa... 35 0.18
sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing... 35 0.23
sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing... 35 0.23
sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from tra... 33 0.51
sp|Q2FXX2|Y1708_STAA8 UPF0271 protein SAOUHSC_01708 OS=Staphyloc... 32 1.9
sp|A6U274|Y1696_STAA2 UPF0271 protein SaurJH1_1696 OS=Staphyloco... 32 1.9
sp|A5ITD0|Y1662_STAA9 UPF0271 protein SaurJH9_1662 OS=Staphyloco... 32 1.9
sp|Q5HFF7|Y1660_STAAC UPF0271 protein SACOL1660 OS=Staphylococcu... 32 1.9
sp|A8Z4E3|Y1605_STAAT UPF0271 protein USA300HOU_1605 OS=Staphylo... 32 1.9
sp|P67622|Y1605_STAAM UPF0271 protein SAV1605 OS=Staphylococcus ... 32 1.9
sp|A7X313|Y1592_STAA1 UPF0271 protein SAHV_1592 OS=Staphylococcu... 32 1.9
sp|Q2FGC1|Y1562_STAA3 UPF0271 protein SAUSA300_1562 OS=Staphyloc... 32 1.9
sp|A6QHE6|Y1506_STAAE UPF0271 protein NWMN_1506 OS=Staphylococcu... 32 1.9
sp|P67623|Y1433_STAAN UPF0271 protein SA1433 OS=Staphylococcus a... 32 1.9
sp|Q6GG98|Y1684_STAAR UPF0271 protein SAR1684 OS=Staphylococcus ... 31 2.5
sp|Q8NW95|Y1555_STAAW UPF0271 protein MW1555 OS=Staphylococcus a... 31 2.5
sp|Q6G8W4|Y1541_STAAS UPF0271 protein SAS1541 OS=Staphylococcus ... 31 2.5
sp|Q2YT73|Y1476_STAAB UPF0271 protein SAB1476c OS=Staphylococcus... 31 2.5
sp|Q4JBY6|Y277_SULAC UPF0282 protein Saci_0277 OS=Sulfolobus aci... 31 3.3
sp|P10401|POLY_DROME Retrovirus-related Pol polyprotein from tra... 31 3.3
sp|Q31JC9|THIC_THICR Thiamine biosynthesis protein thiC OS=Thiom... 30 5.6
sp|Q8MJ05|RP1_BOVIN Oxygen-regulated protein 1 OS=Bos taurus GN=... 30 5.6
sp|P36324|POL2_RRVS RNA2 polyprotein OS=Raspberry ringspot virus... 30 5.6
sp|Q75AM2|KAPR_ASHGO cAMP-dependent protein kinase regulatory su... 30 7.4
sp|P27502|POL_RTBVP Polyprotein P3 OS=Rice tungro bacilliform vi... 29 9.6

>sp|P04323|POL3_DROME Retrovirus-related Pol polyprotein from
transposon 17.6 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1058

Score = 38.1 bits (87), Expect = 0.021
Identities = 22/86 (25%), Positives = 43/86 (50%)
Frame = -2

Query: 472 DYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLTPDIAMM*WIAYIKS 293
+Y+ +++ L +V A + + YL G + ++ PL + P+ + W +
Sbjct: 544 NYSTIEKELLAIVWATKTFRHYLLGRHFEISSDHQPL-SWLYRMKDPNSKLTRWRVKLSE 602

Query: 292 LNPEFKHIAGKDNPMADMLSRAMYED 215
+ + K+I GK+N +AD LSR E+
Sbjct: 603 FDFDIKYIKGKENCVADALSRIKLEE 628


>sp|P20825|POL2_DROME Retrovirus-related Pol polyprotein from
transposon 297 OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1059

Score = 37.4 bits (85), Expect = 0.035
Identities = 22/86 (25%), Positives = 42/86 (48%)
Frame = -2

Query: 472 DYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLTPDIAMM*WIAYIKS 293
+Y+ +++ L +V A + + YL G ++ ++ PL + N P + W +
Sbjct: 543 NYSAIEKELLAIVWATKTFRHYLLGRQFLIASDHQPLR-WLHNLKEPGAKLERWRVRLSE 601

Query: 292 LNPEFKHIAGKDNPMADMLSRAMYED 215
+ +I GK+N +AD LSR E+
Sbjct: 602 YQFKIDYIKGKENSVADALSRIKIEE 627


>sp|Q7LHG5|YI31B_YEAST Transposon Ty3-I Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-I PE=3 SV=2
Length = 1498

Score = 35.0 bits (79), Expect = 0.18
Identities = 23/86 (26%), Positives = 44/86 (51%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLTPDIAMM*WIAYI 299
Q++Y + L G++ AL + L G + T+ + LL + N P + W+ +
Sbjct: 953 QKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSL-QNKNEPARRVQRWLDDL 1011

Query: 298 KSLNPEFKHIAGKDNPMADMLSRAMY 221
+ + +++AG N +AD +SRA+Y
Sbjct: 1012 ATYDFTLEYLAGPKNVVADAISRAIY 1037


>sp|Q99315|YG31B_YEAST Transposon Ty3-G Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY3B-G PE=1 SV=3
Length = 1547

Score = 35.0 bits (79), Expect = 0.18
Identities = 23/86 (26%), Positives = 44/86 (51%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLTPDIAMM*WIAYI 299
Q++Y + L G++ AL + L G + T+ + LL + N P + W+ +
Sbjct: 927 QKNYPAGELELLGIIKALHHFRYMLHGKHFTLRTDHISLLSL-QNKNEPARRVQRWLDDL 985

Query: 298 KSLNPEFKHIAGKDNPMADMLSRAMY 221
+ + +++AG N +AD +SRA+Y
Sbjct: 986 ATYDFTLEYLAGPKNVVADAISRAVY 1011


>sp|Q6XKE6|POLG_PVCV2 Genome polyprotein OS=Petunia vein clearing
virus (isolate Hohn) PE=3 SV=1
Length = 2180

Score = 34.7 bits (78), Expect = 0.23
Identities = 16/54 (29%), Positives = 27/54 (50%)
Frame = -2

Query: 391 VVVETNCLPLLGMITNCLTPDIAMM*WIAYIKSLNPEFKHIAGKDNPMADMLSR 230
V ++ P + + + P+ ++ W + E KH+ GKDN +AD LSR
Sbjct: 1752 VEMDMRAFPKMIRLNPKIVPNSQLLRWAQWFSPYQFEVKHLKGKDNILADFLSR 1805


>sp|Q91DM0|POLG_PVCV1 Genome polyprotein OS=Petunia vein clearing
virus (isolate Shepherd) PE=3 SV=1
Length = 2179

Score = 34.7 bits (78), Expect = 0.23
Identities = 16/54 (29%), Positives = 27/54 (50%)
Frame = -2

Query: 391 VVVETNCLPLLGMITNCLTPDIAMM*WIAYIKSLNPEFKHIAGKDNPMADMLSR 230
V ++ P + + + P+ ++ W + E KH+ GKDN +AD LSR
Sbjct: 1751 VEMDMRAFPKMIRLNPKIVPNSQLLRWAQWFSPYQFEVKHLKGKDNILADFLSR 1804


>sp|Q8I7P9|POL5_DROME Retrovirus-related Pol polyprotein from
transposon opus OS=Drosophila melanogaster GN=pol PE=4
SV=1
Length = 1003

Score = 33.5 bits (75), Expect = 0.51
Identities = 25/84 (29%), Positives = 43/84 (51%), Gaps = 1/84 (1%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVV-VETNCLPLLGMITNCLTPDIAMM*WIAY 302
+ +YA +++ + ++ +L + YL GA + V T+ PL + N + + W A
Sbjct: 472 EENYATIEKEMLAIIWSLDNLRAYLYGAGTIKVYTDHQPLTFALGN-RNFNAKLKRWKAR 530

Query: 301 IKSLNPEFKHIAGKDNPMADMLSR 230
I+ N E + GK N +AD LSR
Sbjct: 531 IEEYNCELIYKPGKSNVVADALSR 554


>sp|Q2FXX2|Y1708_STAA8 UPF0271 protein SAOUHSC_01708
OS=Staphylococcus aureus (strain NCTC 8325)
GN=SAOUHSC_01708 PE=3 SV=1
Length = 250

Score = 31.6 bits (70), Expect = 1.9
Identities = 17/68 (25%), Positives = 38/68 (55%)
Frame = -2

Query: 271 IAGKDNPMADMLSRAMYEDEQDMIIEGDDFGTKFYTIDHSKSSHACFVSSLESFAEELYE 92
+ KD +A+++++A+Y+ + +++ G Y I +K+ +++ E FA+ YE
Sbjct: 117 MGAKDREIANVIAQAVYDFDPSLVLVGL---ANSYLISEAKN--VGLITASEVFADRRYE 171

Query: 91 DEWLLIGR 68
D+ L+ R
Sbjct: 172 DDGQLVSR 179


>sp|A6U274|Y1696_STAA2 UPF0271 protein SaurJH1_1696
OS=Staphylococcus aureus (strain JH1) GN=SaurJH1_1696
PE=3 SV=1
Length = 250

Score = 31.6 bits (70), Expect = 1.9
Identities = 17/68 (25%), Positives = 38/68 (55%)
Frame = -2

Query: 271 IAGKDNPMADMLSRAMYEDEQDMIIEGDDFGTKFYTIDHSKSSHACFVSSLESFAEELYE 92
+ KD +A+++++A+Y+ + +++ G Y I +K+ +++ E FA+ YE
Sbjct: 117 MGAKDREIANVIAQAVYDFDPSLVLVGL---ANSYLISEAKN--VGLITASEVFADRRYE 171

Query: 91 DEWLLIGR 68
D+ L+ R
Sbjct: 172 DDGQLVSR 179


>sp|A5ITD0|Y1662_STAA9 UPF0271 protein SaurJH9_1662
OS=Staphylococcus aureus (strain JH9) GN=SaurJH9_1662
PE=3 SV=1
Length = 250

Score = 31.6 bits (70), Expect = 1.9
Identities = 17/68 (25%), Positives = 38/68 (55%)
Frame = -2

Query: 271 IAGKDNPMADMLSRAMYEDEQDMIIEGDDFGTKFYTIDHSKSSHACFVSSLESFAEELYE 92
+ KD +A+++++A+Y+ + +++ G Y I +K+ +++ E FA+ YE
Sbjct: 117 MGAKDREIANVIAQAVYDFDPSLVLVGL---ANSYLISEAKN--VGLITASEVFADRRYE 171

Query: 91 DEWLLIGR 68
D+ L+ R
Sbjct: 172 DDGQLVSR 179


tr_hit_id A9SEB1
Definition tr|A9SEB1|A9SEB1_PHYPA Predicted protein (Fragment) OS=Physcomitrella patens subsp. patens
Align length 75
Score (bit) 108.0
E-value 1.0e-22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919553|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_D09.
(479 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9SEB1|A9SEB1_PHYPA Predicted protein (Fragment) OS=Physcomit... 108 1e-22
tr|Q9C0U1|Q9C0U1_YARLI YALI0A10395p OS=Yarrowia lipolytica GN=ta... 53 9e-06
tr|Q6CHG3|Q6CHG3_YARLI YALI0A08932p OS=Yarrowia lipolytica GN=YA... 53 9e-06
tr|Q6CFJ9|Q6CFJ9_YARLI YALI0B06303p OS=Yarrowia lipolytica GN=YA... 53 9e-06
tr|Q6CFJ4|Q6CFJ4_YARLI YALI0B06446p OS=Yarrowia lipolytica GN=YA... 53 9e-06
tr|Q6C613|Q6C613_YARLI YALI0E13376p OS=Yarrowia lipolytica GN=YA... 53 9e-06
tr|Q6C3G7|Q6C3G7_YARLI YALI0E34980p OS=Yarrowia lipolytica GN=YA... 53 9e-06
tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein OS=Botry... 51 3e-05
tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein OS=Botry... 51 3e-05
tr|Q4EB49|Q4EB49_9RICK Reverse transcriptase polyprotein (Fragme... 49 2e-04
tr|A5BLH3|A5BLH3_VITVI Putative uncharacterized protein OS=Vitis... 49 2e-04
tr|Q9GQ51|Q9GQ51_DICDI Polyprotein OS=Dictyostelium discoideum G... 47 4e-04
tr|Q54VD1|Q54VD1_DICDI Putative uncharacterized protein OS=Dicty... 47 4e-04
tr|Q54AS8|Q54AS8_DICDI Putative uncharacterized protein (Fragmen... 47 4e-04
tr|A8PI98|A8PI98_COPC7 Putative uncharacterized protein OS=Copri... 47 4e-04
tr|A5C6R3|A5C6R3_VITVI Putative uncharacterized protein OS=Vitis... 46 8e-04
tr|Q6H8S0|Q6H8S0_YARLI Polyprotein (Fragment) OS=Yarrowia lipoly... 46 0.001
tr|B5FVH8|B5FVH8_YARLI YALI0E14388p2 OS=Yarrowia lipolytica GN=Y... 46 0.001
tr|A5BCK1|A5BCK1_VITVI Putative uncharacterized protein OS=Vitis... 45 0.001
tr|A5C647|A5C647_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5B4W9|A5B4W9_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5CA60|A5CA60_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BNG4|A5BNG4_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BH24|A5BH24_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5ATF8|A5ATF8_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5AH79|A5AH79_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5AE81|A5AE81_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|A5BH44|A5BH44_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003
tr|A5AE33|A5AE33_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003
tr|A5ACN5|A5ACN5_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003

>tr|A9SEB1|A9SEB1_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_46806 PE=4 SV=1
Length = 75

Score = 108 bits (270), Expect = 1e-22
Identities = 53/75 (70%), Positives = 62/75 (82%)
Frame = -2

Query: 457 KRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLTPDIAMM*WIAYIKSLNPEF 278
KR LW VV A++ +K+YL GA VV+ET+CLPLLGMITN TPDIAM+ WIAYIKSLN EF
Sbjct: 1 KRELWRVVSAMKAEKDYLIGAVVVIETDCLPLLGMITNWSTPDIAMLRWIAYIKSLNLEF 60

Query: 277 KHIAGKDNPMADMLS 233
KH+ KDN +ADMLS
Sbjct: 61 KHVTEKDNLVADMLS 75


>tr|Q9C0U1|Q9C0U1_YARLI YALI0A10395p OS=Yarrowia lipolytica GN=ta PE=4
SV=2
Length = 2621

Score = 52.8 bits (125), Expect = 9e-06
Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+R YA K V AL + Y+ G V+ET+ L+ ++ P+ W A
Sbjct: 1946 ERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSRVELPNAMFTRWFA 2005

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSRAMYED 215
YIK + E + + G+DNP+AD LSR + D
Sbjct: 2006 YIKQFDYEVRFVKGRDNPVADWLSREKFSD 2035


>tr|Q6CHG3|Q6CHG3_YARLI YALI0A08932p OS=Yarrowia lipolytica
GN=YALI0A08932g PE=4 SV=1
Length = 2621

Score = 52.8 bits (125), Expect = 9e-06
Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+R YA K V AL + Y+ G V+ET+ L+ ++ P+ W A
Sbjct: 1946 ERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSRVELPNAMFTRWFA 2005

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSRAMYED 215
YIK + E + + G+DNP+AD LSR + D
Sbjct: 2006 YIKQFDYEVRFVKGRDNPVADWLSREKFSD 2035


>tr|Q6CFJ9|Q6CFJ9_YARLI YALI0B06303p OS=Yarrowia lipolytica
GN=YALI0B06303g PE=4 SV=1
Length = 2621

Score = 52.8 bits (125), Expect = 9e-06
Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+R YA K V AL + Y+ G V+ET+ L+ ++ P+ W A
Sbjct: 1946 ERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSRVELPNAMFTRWFA 2005

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSRAMYED 215
YIK + E + + G+DNP+AD LSR + D
Sbjct: 2006 YIKQFDYEVRFVKGRDNPVADWLSREKFSD 2035


>tr|Q6CFJ4|Q6CFJ4_YARLI YALI0B06446p OS=Yarrowia lipolytica
GN=YALI0B06446g PE=4 SV=1
Length = 2621

Score = 52.8 bits (125), Expect = 9e-06
Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+R YA K V AL + Y+ G V+ET+ L+ ++ P+ W A
Sbjct: 1946 ERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSRVELPNAMFTRWFA 2005

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSRAMYED 215
YIK + E + + G+DNP+AD LSR + D
Sbjct: 2006 YIKQFDYEVRFVKGRDNPVADWLSREKFSD 2035


>tr|Q6C613|Q6C613_YARLI YALI0E13376p OS=Yarrowia lipolytica
GN=YALI0E13376g PE=4 SV=1
Length = 2621

Score = 52.8 bits (125), Expect = 9e-06
Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+R YA K V AL + Y+ G V+ET+ L+ ++ P+ W A
Sbjct: 1946 ERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSRVELPNAMFTRWFA 2005

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSRAMYED 215
YIK + E + + G+DNP+AD LSR + D
Sbjct: 2006 YIKQFDYEVRFVKGRDNPVADWLSREKFSD 2035


>tr|Q6C3G7|Q6C3G7_YARLI YALI0E34980p OS=Yarrowia lipolytica
GN=YALI0E34980g PE=4 SV=1
Length = 2621

Score = 52.8 bits (125), Expect = 9e-06
Identities = 30/90 (33%), Positives = 45/90 (50%), Gaps = 2/90 (2%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+R YA K V AL + Y+ G V+ET+ L+ ++ P+ W A
Sbjct: 1946 ERTYASTKTECLAVKRALEKCRHYVTGVHFVIETDNQALVFLLQQSRVELPNAMFTRWFA 2005

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSRAMYED 215
YIK + E + + G+DNP+AD LSR + D
Sbjct: 2006 YIKQFDYEVRFVKGRDNPVADWLSREKFSD 2035


>tr|A6SHV6|A6SHV6_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_12337
PE=4 SV=1
Length = 1114

Score = 51.2 bits (121), Expect = 3e-05
Identities = 44/167 (26%), Positives = 76/167 (45%), Gaps = 9/167 (5%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+++Y KR GV+ ALR + L G V+ET+ L+ + T P + WIA
Sbjct: 476 EKNYDATKRECRGVLKALRKCRFDLYGIHFVLETDAKVLVAQLNRAATDLPGALVTRWIA 535

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSR-------AMYEDEQDMIIEGDDFGTKFYTIDHSKS 146
+I+ + E +H+ G + AD LSR ED+++ I E + ++ +
Sbjct: 536 WIRLFDFEVRHVKGTAHTAADGLSRRPATLSEVSEEDKEEDIDEW--IADQLNNVEDVST 593

Query: 145 SHACFVSSLESFAEELYEDEWLLIGRY*NNLQK*DDWTEQEFKRIRR 5
H S ++ Y E I +Y +LQ+ + T QEF + ++
Sbjct: 594 IHNFANFSRSYELDKGYNSESRKIAQYLTSLQRPEGMTSQEFSKFKK 640


>tr|A6RNZ8|A6RNZ8_BOTFB Putative uncharacterized protein
OS=Botryotinia fuckeliana (strain B05.10) GN=BC1G_02171
PE=4 SV=1
Length = 1114

Score = 51.2 bits (121), Expect = 3e-05
Identities = 44/167 (26%), Positives = 76/167 (45%), Gaps = 9/167 (5%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGASVVVETNCLPLLGMITNCLT--PDIAMM*WIA 305
+++Y KR GV+ ALR + L G V+ET+ L+ + T P + WIA
Sbjct: 476 EKNYDATKRECRGVLKALRKCRFDLYGIHFVLETDAKVLVAQLNRAATDLPGALVTRWIA 535

Query: 304 YIKSLNPEFKHIAGKDNPMADMLSR-------AMYEDEQDMIIEGDDFGTKFYTIDHSKS 146
+I+ + E +H+ G + AD LSR ED+++ I E + ++ +
Sbjct: 536 WIRLFDFEVRHVKGTAHTAADGLSRRPATLSDVSEEDKEEDIDEW--IADQLNNVEDVST 593

Query: 145 SHACFVSSLESFAEELYEDEWLLIGRY*NNLQK*DDWTEQEFKRIRR 5
H S ++ Y E I +Y +LQ+ + T QEF + ++
Sbjct: 594 IHNFANFSRSYELDKGYNSESRKIAQYLTSLQRPEGMTSQEFSKFKK 640


>tr|Q4EB49|Q4EB49_9RICK Reverse transcriptase polyprotein (Fragment)
OS=Wolbachia endosymbiont of Drosophila ananassae
GN=WwAna1712 PE=4 SV=1
Length = 607

Score = 48.5 bits (114), Expect = 2e-04
Identities = 33/104 (31%), Positives = 56/104 (53%), Gaps = 2/104 (1%)
Frame = -2

Query: 478 QRDYAQVKRVLWGVVIALRCDKEYLKGAS-VVVETNCLPLLGMITNCLTPDIAMM*WIAY 302
+R+YA K+ L +V AL+ + YL G S + + T+ L I++ P++ + W Y
Sbjct: 102 ERNYATNKKELLAIVWALKNLRNYLYGVSGIEIHTDHQSLSYAISD-KNPNVELKRWFNY 160

Query: 301 IKSLNPEFKHIAGKDNPMADMLSRAMYED-EQDMIIEGDDFGTK 173
I+S P+ + G N +AD LSR + +D +E D+GT+
Sbjct: 161 IESFRPKILYKPGTTNVVADALSRIEINNITEDEDVESTDYGTQ 204