BP919558
Clone id YMU001_000126_E02
Library
Length 558
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000126_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAGATGTCGAATCTCAGCCTTAATAATCATGACTACATTTCGCCAAAATCACATCAAATG
GTCATACGACGACGGAACGACTAAGCGGTTCGACCCACAGATGGTATGCAGATTATATCG
GGATCAAAGGTGAGGAAAATCAGCCCTGTGTCACGAAAATCTCGGGAAGATATAGGCCAG
ATAGGCCAAAATCTAGCTCATTGTTCATTTTCACCTTTTGAGAGAGAAGGAGAGAGCTTT
TTGACCTAGAGCTGCCACGGTTCTACCCGGTACGGACGGTCGGAGCCAGCATTTCACACC
AGATTCCACAGGTATGTTCCTTATCAAGTAAAGATCAAGTCTATTACGCATGCAAGCGCG
AATCTTTGCACAAATGGGCGAAGGGATCAAAACAAAGTCGGATCGGGTCAAAGAGGTCAA
GGGCCCTTAGAGGCATCCAAGCAAAATTTTTTTCAGGAACAGAACACATCAATGTGCTCC
CCACAAGGTCAGGAATAAATCCATATGGTCAAATCACAAATTGGTGGTGATACACCGATT
ACAATCGGTGTACCTCAC
■■Homology search results ■■ -
sp_hit_id Q13EN7
Definition sp|Q13EN7|FPG_RHOPS Formamidopyrimidine-DNA glycosylase OS=Rhodopseudomonas palustris (strain BisB5)
Align length 83
Score (bit) 36.2
E-value 0.11
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919558|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_E02.
(558 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q13EN7|FPG_RHOPS Formamidopyrimidine-DNA glycosylase OS=Rhodo... 36 0.11
sp|Q2J2I0|FPG_RHOP2 Formamidopyrimidine-DNA glycosylase OS=Rhodo... 35 0.19
sp|Q7TQC5|APTX_MOUSE Aprataxin OS=Mus musculus GN=Aptx PE=2 SV=2 30 6.1

>sp|Q13EN7|FPG_RHOPS Formamidopyrimidine-DNA glycosylase
OS=Rhodopseudomonas palustris (strain BisB5) GN=mutM
PE=3 SV=1
Length = 293

Score = 36.2 bits (82), Expect = 0.11
Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%)
Frame = +1

Query: 34 YISPKSHQMVIRRRN----D*AVRPTDGMQIISGSKVRKISPVSRKSREDIGQIGQNLAH 201
++SPK + R D A+R TD ++ + G ++ R R+ G++G H
Sbjct: 196 HLSPKRKAATLANRKNEPTDHALRLTDAIRAVLGDAIKAGGSSLRDHRQTSGELGY-FQH 254

Query: 202 CSFSPFEREGESFLT*SCHGSTR 270
SF+ ++REGE T C G+ +
Sbjct: 255 -SFAAYDREGERCRTDGCGGAVK 276


>sp|Q2J2I0|FPG_RHOP2 Formamidopyrimidine-DNA glycosylase
OS=Rhodopseudomonas palustris (strain HaA2) GN=mutM PE=3
SV=1
Length = 293

Score = 35.4 bits (80), Expect = 0.19
Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 4/83 (4%)
Frame = +1

Query: 34 YISPKSHQMVIRRRN----D*AVRPTDGMQIISGSKVRKISPVSRKSREDIGQIGQNLAH 201
++SPK + R D AVR D ++ + G ++ R R+ G++G H
Sbjct: 196 HLSPKRKASTLADRKGAPTDRAVRLVDAIRAVLGDAIKAGGSSLRDHRQTSGELGY-FQH 254

Query: 202 CSFSPFEREGESFLT*SCHGSTR 270
SF+ ++REGE T C+G+ +
Sbjct: 255 -SFAVYDREGERCRTPGCNGTVK 276


>sp|Q7TQC5|APTX_MOUSE Aprataxin OS=Mus musculus GN=Aptx PE=2 SV=2
Length = 342

Score = 30.4 bits (67), Expect = 6.1
Identities = 22/66 (33%), Positives = 30/66 (45%), Gaps = 4/66 (6%)
Frame = +3

Query: 306 PQVCSLSSKDQVYYACKRESLHKWAKGSKQSRIGSK----RSRALRGIQAKFFSGTEHIN 473
P CS+S K A K+ESL W++G K S K + + I+ K+ H
Sbjct: 144 PSQCSVSPKKDKNGATKKESLGHWSQGLKMSMKDPKMQVYKDDQVVVIKDKYPKARHHWL 203

Query: 474 VLPTRS 491
VLP S
Sbjct: 204 VLPWAS 209


tr_hit_id A8PDQ4
Definition tr|A8PDQ4|A8PDQ4_BRUMA Ubiquitin carboxyl-terminal hydrolase OS=Brugia malayi
Align length 88
Score (bit) 35.8
E-value 1.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919558|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_E02.
(558 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A8PDQ4|A8PDQ4_BRUMA Ubiquitin carboxyl-terminal hydrolase OS=... 36 1.6

>tr|A8PDQ4|A8PDQ4_BRUMA Ubiquitin carboxyl-terminal hydrolase
OS=Brugia malayi GN=Bm1_22850 PE=3 SV=1
Length = 968

Score = 35.8 bits (81), Expect = 1.6
Identities = 28/88 (31%), Positives = 39/88 (44%), Gaps = 8/88 (9%)
Frame = +3

Query: 285 ASISHQI-PQVCSLSSKDQVYYACKRESLHKWAKGSKQSRIGSKRSRALRGIQAKFFSGT 461
A ++H I P+ C + S D+ Y KR+ ++W G Q S S ALR T
Sbjct: 69 AELAHDIIPEECQMRSDDREYVLKKRDP-NQWTSGLLQCNSSSALS-ALRSSSTTTSPHT 126

Query: 462 E-------HINVLPTRSGINPYGQITNW 524
+I RSG+ P GQ +NW
Sbjct: 127 SRPSISYRYIGSTADRSGLPPTGQSSNW 154