BP919567
Clone id YMU001_000126_F01
Library
Length 492
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000126_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ACATGAGCCAAGAAGCCGCGGGGCCTCTGGCTGTGAGAGGTCTGAGAGAGAATAAGTAGC
CAAGGTGGGCTGTTAGCAACACCGTCACTTGGATCATCTGATAACTAGTAGTTTAAGCTC
CCGTTTTACAGGATTAACCGGGCCGTTAACGACACCGGGGCTTAATAAGATGATTAATTA
ATCTTCAGATTGATAACGGGTGAAGGAAATTTTCACCTGTCACTTTACCTGCTTCAATTG
CCCCTTGGATTCTGCAAACTTTAATTCTGCTCATTGCCTCAATCTTCATGCTTAAATTAT
TGTCGAATGTTCTGCAGCTTCCTGCTTTGTGTGCTTTGCACTACCTTAATTGCCGTTCAC
AAGCTTTGACTTTCTCCTCTAATCGACTTGCTCTGATTGCCTTCAAGCTTTGTATGCCCT
TGGTGATTTCTCTTACCAATCTCAATAGAGTGAGAGAAGCTTCCTCTTCTTCTAGCTTTC
ATGCTTGCTCCC
■■Homology search results ■■ -
sp_hit_id Q54LB5
Definition sp|Q54LB5|Y7118_DICDI Uncharacterized transmembrane protein DDB_G0286729 OS=Dictyostelium discoideum
Align length 87
Score (bit) 30.4
E-value 4.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919567|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_F01.
(492 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q54LB5|Y7118_DICDI Uncharacterized transmembrane protein DDB_... 30 4.5
sp|Q9J560|V173_FOWPV Protein FPV173 OS=Fowlpox virus GN=FPV173 P... 30 7.8

>sp|Q54LB5|Y7118_DICDI Uncharacterized transmembrane protein
DDB_G0286729 OS=Dictyostelium discoideum GN=DDB_G0286729
PE=4 SV=1
Length = 261

Score = 30.4 bits (67), Expect = 4.5
Identities = 19/87 (21%), Positives = 41/87 (47%), Gaps = 12/87 (13%)
Frame = +3

Query: 231 ASIAPWILQTLILLIASIFMLKLLSNVLQLPA-------LCALHYLNCR-----SQALTF 374
+++ PW+ Q +IL + F+L ++ +L L A + +H+L S F
Sbjct: 83 STVGPWLYQIIILFFSQQFLLFSIAPILGLFAMYTQNRCIVVMHFLTAAFYYIFSVIFLF 142

Query: 375 SSNRLALIAFKLCMPLVISLTNLNRVR 455
S +++ I + ++ +L+ +N R
Sbjct: 143 SGDQINTILLSILFSIIFTLSLMNYSR 169


>sp|Q9J560|V173_FOWPV Protein FPV173 OS=Fowlpox virus GN=FPV173 PE=3
SV=1
Length = 76

Score = 29.6 bits (65), Expect = 7.8
Identities = 15/52 (28%), Positives = 29/52 (55%)
Frame = +3

Query: 273 IASIFMLKLLSNVLQLPALCALHYLNCRSQALTFSSNRLALIAFKLCMPLVI 428
I+++ L++ SNV++L C +H+ R + N LA + K+ + +VI
Sbjct: 11 ISTLAFLQVASNVIELVRHCIMHFCETRIRC-----NTLAFVILKILITMVI 57


tr_hit_id A1WPZ9
Definition tr|A1WPZ9|A1WPZ9_VEREI Thiamine pyrophosphate enzyme domain protein TPP-binding OS=Verminephrobacter eiseniae (strain EF01-2)
Align length 115
Score (bit) 35.8
E-value 1.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919567|Adiantum capillus-veneris mRNA, clone:
YMU001_000126_F01.
(492 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A1WPZ9|A1WPZ9_VEREI Thiamine pyrophosphate enzyme domain prot... 36 1.1
tr|B6K9D9|B6K9D9_TOXGO Dolichyl pyrophosphate Glc1Man9GlcNAc2 al... 34 3.2

>tr|A1WPZ9|A1WPZ9_VEREI Thiamine pyrophosphate enzyme domain protein
TPP-binding OS=Verminephrobacter eiseniae (strain
EF01-2) GN=Veis_3999 PE=3 SV=1
Length = 605

Score = 35.8 bits (81), Expect = 1.1
Identities = 33/115 (28%), Positives = 50/115 (43%), Gaps = 7/115 (6%)
Frame = -3

Query: 478 KLEEEEASLTLLRLVREITKGIQSLKAIRASRLEEKVKACERQLR*CKAHKAGSCRT--- 308
K+ + EA T L LV++IT GI A L +++ R L C A++AG RT
Sbjct: 308 KIIQVEADHTNLGLVKKITVGIHGDAKASARELLRRLQG--RALA-CDANRAGRARTIGA 364

Query: 307 ----FDNNLSMKIEAMSRIKVCRIQGAIEAGKVTGENFLHPLSI*RLINHLIKPR 155
++ L + I+ A TG N+LHP + R + + PR
Sbjct: 365 EKAAWEKELDEWTHERDPFSLDAIEEARGEKTATGGNYLHPRQVLRELEKAMPPR 419


>tr|B6K9D9|B6K9D9_TOXGO Dolichyl pyrophosphate Glc1Man9GlcNAc2
alpha-1,3-glucosyltransferase, putative OS=Toxoplasma
gondii ME49 GN=TGME49_114730 PE=4 SV=1
Length = 914

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/41 (43%), Positives = 26/41 (63%)
Frame = +3

Query: 219 VTLPASIAPWILQTLILLIASIFMLKLLSNVLQLPALCALH 341
V++P S+A W LQ ILL++S F++ L N+ LP L H
Sbjct: 507 VSVPLSVAAWTLQDSILLVSS-FLVNFLGNLAILPLLPRPH 546