BP919603
Clone id YMU001_000127_A09
Library
Length 501
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_A09.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAAGGAAAGGGCCTTGACAGGGTAGGCTGAACACCCGAAGACTTGGAGGTGCTGCAGATC
TGGAATTTTACCAAACCAATGGTAGTATGGGGTGTATTGGGGATCAATTGCATGTGGTAT
GCAATTTTGAAGGTAGCCAGCAGTGGCAACTGCTTCCCCCAGTATGCCTTTGATAGGCCT
GCCGTGAGTAGCATGGCACGTGAAGCTGCAACTAAGGTGCGATTCTTCCTTTCGGCGACC
CCATTTTGCTGCGGTGTGTAGGGGACAGTGAATTGTTGTTGTATGCCCTCATCCATGCAA
AAGTTTTTAAATGCATTGGTGACATACTCTCCTCCATTGTCCGAGCGAAGAGCCTGCACG
GGTAGATCATGCTGTCGCACTACCAACCTGCAGTACTCTTTGAAGCTTGAGAGAACTTGT
GACTTTTGCTTCAAGAAATATATTGTAGTGTACCTGCTGAAATTATCAATAAATGTTAGA
AAGTAAAAAAAAAAAAAAAAA
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 105
Score (bit) 101.0
E-value 8.0e-26
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919603|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_A09.
(468 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 101 8e-26
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 92 1e-18
sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficienc... 54 3e-07
sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficienc... 54 3e-07
sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein OS=... 52 1e-06
sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12503|YF21B_YEAST Transposon Ty2-F/Ty2-GR2 Gag-Pol polyprote... 52 1e-06
sp|Q07791|YD23B_YEAST Transposon Ty2-DR3 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q03494|YD22B_YEAST Transposon Ty2-DR2 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12472|YD21B_YEAST Transposon Ty2-DR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|P25384|YC21B_YEAST Transposon Ty2-C Gag-Pol polyprotein OS=Sa... 52 1e-06
sp|Q12491|YB21B_YEAST Transposon Ty2-B Gag-Pol polyprotein OS=Sa... 52 1e-06
sp|P0C2J7|YH41B_YEAST Transposon Ty4-H Gag-Pol polyprotein OS=Sa... 52 1e-06
sp|P47024|YJ41B_YEAST Transposon Ty4-J Gag-Pol polyprotein OS=Sa... 51 2e-06
sp|Q1A267|POL_SIVMB Gag-Pol polyprotein OS=Simian immunodeficien... 51 3e-06
sp|Q9QBZ5|POL_HV1MP Gag-Pol polyprotein OS=Human immunodeficienc... 50 4e-06
sp|Q9QSR3|POL_HV1VI Gag-Pol polyprotein OS=Human immunodeficienc... 50 5e-06
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=... 50 6e-06
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=... 50 6e-06
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=S... 50 6e-06
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=S... 50 6e-06
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=S... 50 6e-06
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=... 50 6e-06
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=... 50 6e-06
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=... 50 6e-06
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=... 50 6e-06
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=... 50 6e-06

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 101 bits (252), Expect(2) = 8e-26
Identities = 50/105 (47%), Positives = 68/105 (64%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+ SR +Y LK K QV F+++ LV R+ ++ LRSDNGGEY + F+ +C
Sbjct: 508 DDASRKLWVYILKTKDQVFQVFQKFHALVERETGRKLKRLRSDNGGEYTSREFEEYCSSH 567

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI+ + TVP TPQ NGVAER NRT+V R+ML A L K++WG+
Sbjct: 568 GIRHEKTVPGTPQHNGVAERMNRTIVEKVRSMLRMAKLPKSFWGE 612



Score = 35.4 bits (80), Expect(2) = 8e-26
Identities = 21/50 (42%), Positives = 23/50 (46%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K GEAV TA YL N P P W K HL+VFGC A+
Sbjct: 607 KSFWGEAVQTACYLINRSPSVPLAFEIPERVWTNKEVSYSHLKVFGCRAF 656


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster
GN=GIP PE=1 SV=3
Length = 1409

Score = 92.0 bits (227), Expect = 1e-18
Identities = 47/115 (40%), Positives = 68/115 (59%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D F+ Y Y +K KS V S F+++ +L V L DNG EY++N + FC+ +
Sbjct: 508 DQFTHYCVTYLIKYKSDVFSMFQDFVAKSEAHFNLKVVYLYIDNGREYLSNEMRQFCVKK 567

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGKQLPLLATFKI 123
GI TVP+TPQ NGV+ER RT+ +R M+ A L K++WG+ + L AT+ I
Sbjct: 568 GISYHLTVPHTPQLNGVSERMIRTITEKARTMVSGAKLDKSFWGEAV-LTATYLI 621



Score = 48.5 bits (114), Expect = 1e-05
Identities = 26/52 (50%), Positives = 30/52 (57%), Gaps = 2/52 (3%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHA--IDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K GEAV TA YL N IP +D TPY W K P L+HL+VFG + Y
Sbjct: 607 KSFWGEAVLTATYLINRIPSRALVDSSKTPYEMWHNKKPYLKHLRVFGATVY 658


>sp|Q75002|POL_HV1ET Gag-Pol polyprotein OS=Human immunodeficiency
virus type 1 (isolate ETH2220 group M subtype C)
GN=gag-pol PE=3 SV=3
Length = 1439

Score = 54.3 bits (129), Expect = 3e-07
Identities = 23/50 (46%), Positives = 31/50 (62%)
Frame = -2

Query: 362 PVQALRSDNGGEYVTNAFKNFCMDEGIQQQFTVPYTPQQNGVAERKNRTL 213
PV+ + +DNG + +NA K C GIQQ+F +PY PQ GV E N+ L
Sbjct: 1260 PVRVIHTDNGSNFTSNAVKAACWWAGIQQEFGIPYNPQSQGVVESMNKEL 1309


>sp|O12158|POL_HV192 Gag-Pol polyprotein OS=Human immunodeficiency
virus type 1 (isolate 92BR025 group M subtype C)
GN=gag-pol PE=1 SV=2
Length = 1431

Score = 53.9 bits (128), Expect = 3e-07
Identities = 22/50 (44%), Positives = 31/50 (62%)
Frame = -2

Query: 362 PVQALRSDNGGEYVTNAFKNFCMDEGIQQQFTVPYTPQQNGVAERKNRTL 213
PV+ + +DNG +++N K C GIQQ+F +PY PQ GV E N+ L
Sbjct: 1252 PVKVIHTDNGSNFISNTVKAACWWAGIQQEFGIPYNPQSQGVVESMNKEL 1301


>sp|Q12501|YO22B_YEAST Transposon Ty2-OR2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-OR2 PE=3 SV=1
Length = 1770

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = -2

Query: 467 DNFSRYTTIYFL--KQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCM 294
D +R+ +Y L +++ +L+ F + Q + V ++ D G EY F
Sbjct: 688 DEKTRFQWVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFT 747

Query: 293 DEGIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYW 159
+ GI +T + +GVAER NRTL+ R +L +GL W
Sbjct: 748 NRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLW 792


>sp|Q12113|YO21B_YEAST Transposon Ty2-OR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-OR1 PE=3 SV=1
Length = 1770

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = -2

Query: 467 DNFSRYTTIYFL--KQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCM 294
D +R+ +Y L +++ +L+ F + Q + V ++ D G EY F
Sbjct: 688 DEKTRFQWVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFT 747

Query: 293 DEGIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYW 159
+ GI +T + +GVAER NRTL+ R +L +GL W
Sbjct: 748 NRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLW 792


>sp|P0C2J5|YL22B_YEAST Transposon Ty2-LR2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-LR2 PE=2 SV=1
Length = 1598

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = -2

Query: 467 DNFSRYTTIYFL--KQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCM 294
D +R+ +Y L +++ +L+ F + Q + V ++ D G EY F
Sbjct: 688 DEKTRFQWVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFT 747

Query: 293 DEGIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYW 159
+ GI +T + +GVAER NRTL+ R +L +GL W
Sbjct: 748 NRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLW 792


>sp|P0C2J3|YL21B_YEAST Transposon Ty2-LR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-LR1 PE=3 SV=1
Length = 1770

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = -2

Query: 467 DNFSRYTTIYFL--KQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCM 294
D +R+ +Y L +++ +L+ F + Q + V ++ D G EY F
Sbjct: 688 DEKTRFQWVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFT 747

Query: 293 DEGIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYW 159
+ GI +T + +GVAER NRTL+ R +L +GL W
Sbjct: 748 NRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLW 792


>sp|Q12337|YG21B_YEAST Transposon Ty2-GR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-GR1 PE=2 SV=2
Length = 1770

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = -2

Query: 467 DNFSRYTTIYFL--KQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCM 294
D +R+ +Y L +++ +L+ F + Q + V ++ D G EY F
Sbjct: 688 DEKTRFQWVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFT 747

Query: 293 DEGIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYW 159
+ GI +T + +GVAER NRTL+ R +L +GL W
Sbjct: 748 NRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLW 792


>sp|Q12503|YF21B_YEAST Transposon Ty2-F/Ty2-GR2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY2B-F PE=2 SV=1
Length = 1770

Score = 52.4 bits (124), Expect = 1e-06
Identities = 30/105 (28%), Positives = 49/105 (46%), Gaps = 2/105 (1%)
Frame = -2

Query: 467 DNFSRYTTIYFL--KQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCM 294
D +R+ +Y L +++ +L+ F + Q + V ++ D G EY F
Sbjct: 688 DEKTRFQWVYPLHDRREESILNVFTSILAFIKNQFNARVLVIQMDRGSEYTNKTLHKFFT 747

Query: 293 DEGIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYW 159
+ GI +T + +GVAER NRTL+ R +L +GL W
Sbjct: 748 NRGITACYTTTADSRAHGVAERLNRTLLNDCRTLLHCSGLPNHLW 792


tr_hit_id Q8WSJ0
Definition tr|Q8WSJ0|Q8WSJ0_ANOGA Polyprotein (Fragment) OS=Anopheles gambiae
Align length 105
Score (bit) 113.0
E-value 1.0e-31
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919603|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_A09.
(468 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q8WSJ0|Q8WSJ0_ANOGA Polyprotein (Fragment) OS=Anopheles gambi... 113 1e-31
tr|A5BLB0|A5BLB0_VITVI Putative uncharacterized protein OS=Vitis... 115 5e-30
tr|Q9LH44|Q9LH44_ARATH Copia-like retrotransposable element OS=A... 105 2e-29
tr|A5BPR9|A5BPR9_VITVI Putative uncharacterized protein OS=Vitis... 112 1e-28
tr|A5BR97|A5BR97_VITVI Putative uncharacterized protein OS=Vitis... 112 2e-28
tr|Q6I5H9|Q6I5H9_ORYSJ Putative polyprotein OS=Oryza sativa subs... 101 2e-28
tr|Q9FWI2|Q9FWI2_ORYSJ Os10g0106900 protein OS=Oryza sativa subs... 101 3e-28
tr|A5AL21|A5AL21_VITVI Putative uncharacterized protein OS=Vitis... 105 3e-28
tr|Q2QLK1|Q2QLK1_ORYSJ Retrotransposon protein, putative, unclas... 101 3e-28
tr|Q8W3A4|Q8W3A4_ORYSA Putative gag-pol polyprotein OS=Oryza sat... 101 3e-28
tr|Q10KL1|Q10KL1_ORYSJ Retrotransposon protein, putative, unclas... 101 3e-28
tr|Q2QXM6|Q2QXM6_ORYSJ Retrotransposon protein, putative, unclas... 101 3e-28
tr|A5BPC1|A5BPC1_VITVI Putative uncharacterized protein OS=Vitis... 105 4e-28
tr|A5BT67|A5BT67_VITVI Putative uncharacterized protein OS=Vitis... 103 5e-28
tr|Q01LI0|Q01LI0_ORYSA OSIGBa0134J07.9 protein OS=Oryza sativa G... 102 9e-28
tr|A5AHH2|A5AHH2_VITVI Putative uncharacterized protein OS=Vitis... 102 1e-27
tr|Q6BCY1|Q6BCY1_IPOBA Gag-Pol OS=Ipomoea batatas GN=Rtsp-1AA PE... 110 3e-27
tr|Q9M197|Q9M197_ARATH Copia-type reverse transcriptase-like pro... 108 3e-27
tr|A5C3Q8|A5C3Q8_VITVI Putative uncharacterized protein OS=Vitis... 108 3e-27
tr|Q9C536|Q9C536_ARATH Copia-type polyprotein, putative OS=Arabi... 108 3e-27
tr|B8YLY4|B8YLY4_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 108 3e-27
tr|B8YLY6|B8YLY6_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 109 4e-27
tr|B8YLY3|B8YLY3_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 107 6e-27
tr|B4MVS9|B4MVS9_DROWI GK15001 OS=Drosophila willistoni GN=GK150... 105 6e-27
tr|Q7XTM9|Q7XTM9_ORYSJ OSJNBa0033G05.13 protein OS=Oryza sativa ... 108 6e-27
tr|Q6L3X6|Q6L3X6_SOLDE Polyprotein, putative OS=Solanum demissum... 98 9e-27
tr|A5AWP3|A5AWP3_VITVI Putative uncharacterized protein OS=Vitis... 100 9e-27
tr|Q9SXB2|Q9SXB2_ARATH T28P6.8 protein OS=Arabidopsis thaliana G... 106 9e-27
tr|Q9M2D1|Q9M2D1_ARATH Copia-type polyprotein OS=Arabidopsis tha... 106 9e-27
tr|B8LKX7|B8LKX7_PICSI Putative uncharacterized protein OS=Picea... 107 1e-26

>tr|Q8WSJ0|Q8WSJ0_ANOGA Polyprotein (Fragment) OS=Anopheles gambiae
PE=4 SV=1
Length = 786

Score = 113 bits (283), Expect(2) = 1e-31
Identities = 53/105 (50%), Positives = 68/105 (64%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+ SRYT +YFLK+KS+ EY +LV Q + +RSD GGEY A + FC DE
Sbjct: 366 DDHSRYTFVYFLKKKSEAEDKIHEYVKLVQNQFGRKPRIIRSDQGGEYSNKALRKFCADE 425

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI+ +FT Y+PQQNGVAERKNR+L R ML AG+ K +W +
Sbjct: 426 GIKMEFTAAYSPQQNGVAERKNRSLTEMGRCMLRDAGMHKRFWAE 470



Score = 46.2 bits (108), Expect(2) = 1e-31
Identities = 24/50 (48%), Positives = 31/50 (62%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K EAV TA YLQN +P A + TP+ WFG+ PDL +L++F C Y
Sbjct: 465 KRFWAEAVNTACYLQNRLPSAA-VERTPFEIWFGRKPDLTNLRLFXCVGY 513


>tr|A5BLB0|A5BLB0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_024577 PE=4 SV=1
Length = 1424

Score = 115 bits (287), Expect(2) = 5e-30
Identities = 52/105 (49%), Positives = 75/105 (71%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+F+R T ++F+KQKS+V S FK++ V +Q ++ LRSD G EY ++ F NFC DE
Sbjct: 619 DDFTRMTWVFFMKQKSEVFSIFKKFKSFVEKQSGCYIKTLRSDRGMEYTSSQFGNFCEDE 678

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
G+++Q TV YTPQQNGV ERKN+T++ ++AML GL K +W +
Sbjct: 679 GVERQLTVAYTPQQNGVVERKNQTVMEMAKAMLYEKGLPKIFWAE 723



Score = 39.7 bits (91), Expect(2) = 5e-30
Identities = 20/45 (44%), Positives = 24/45 (53%)
Frame = -1

Query: 156 EAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
EAV TA YL N P TP W G+ P ++H +VFGC Y
Sbjct: 723 EAVNTAVYLLNRCPTKALLNKTPIEAWSGRKPSVRHFKVFGCLCY 767


>tr|Q9LH44|Q9LH44_ARATH Copia-like retrotransposable element
OS=Arabidopsis thaliana PE=4 SV=1
Length = 1499

Score = 105 bits (263), Expect(2) = 2e-29
Identities = 48/107 (44%), Positives = 71/107 (66%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+FSR T +YFLK KS+V++ FK + V Q + ++ LR+D GGE+++ F C +
Sbjct: 543 DDFSRMTWVYFLKNKSEVITKFKIFKPYVENQSESRIKRLRTDGGGEFLSREFIKLCQES 602

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGKQL 147
GI + T PY+PQQNGVAER+NRTLV +R+M+ LS +W + +
Sbjct: 603 GIHHEITTPYSPQQNGVAERRNRTLVEMARSMIEEKKLSNKFWAEAI 649



Score = 47.0 bits (110), Expect(2) = 2e-29
Identities = 22/46 (47%), Positives = 30/46 (65%), Gaps = 1/46 (2%)
Frame = -1

Query: 156 EAVATAGYLQNCIPH-AIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
EA+AT+ YLQN +P +++ TP W GK P + HL+VFGC Y
Sbjct: 647 EAIATSTYLQNRLPSKSLEKGVTPMEIWSGKKPSVDHLKVFGCVCY 692


>tr|A5BPR9|A5BPR9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013624 PE=4 SV=1
Length = 1269

Score = 112 bits (281), Expect(2) = 1e-28
Identities = 54/105 (51%), Positives = 70/105 (66%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+FSR T +YFLK KSQVLS FK + ++V Q V+ LR+DNGGEY + F FC +
Sbjct: 532 DDFSRMTWVYFLKTKSQVLSMFKSFKKMVETQSGQNVKVLRTDNGGEYTSKEFSVFCQEA 591

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI Q T PY+PQQNGV++RKNRT++ +R ML L K W +
Sbjct: 592 GIVHQLTAPYSPQQNGVSKRKNRTVMEMARCMLFEKKLPKLLWAE 636



Score = 37.0 bits (84), Expect(2) = 1e-28
Identities = 20/50 (40%), Positives = 26/50 (52%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K + EAV T+ YL N +P TP W G P ++HL+VFG Y
Sbjct: 631 KLLWAEAVNTSVYLLNRLPTKSVQSKTPIEAWSGVKPSVKHLKVFGSFCY 680


>tr|A5BR97|A5BR97_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037104 PE=4 SV=1
Length = 2041

Score = 112 bits (280), Expect(2) = 2e-28
Identities = 54/105 (51%), Positives = 69/105 (65%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+FSR T +YFLK KSQVLS FK + ++V Q V+ LR+DNGGEY + F FC +
Sbjct: 1265 DDFSRMTWVYFLKTKSQVLSMFKSFKKMVETQSGQXVKVLRTDNGGEYTSKEFSVFCQEA 1324

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI Q T PY+PQ NGV+ERKNRT++ +R ML L K W +
Sbjct: 1325 GIVHQLTAPYSPQXNGVSERKNRTVMEMARCMLFEKKLPKLLWAE 1369



Score = 37.0 bits (84), Expect(2) = 2e-28
Identities = 20/50 (40%), Positives = 26/50 (52%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K + EAV T+ YL N +P TP W G P ++HL+VFG Y
Sbjct: 1364 KLLWAEAVNTSVYLLNRLPTKSVQSKTPIEAWSGVKPSVKHLKVFGSFCY 1413


>tr|Q6I5H9|Q6I5H9_ORYSJ Putative polyprotein OS=Oryza sativa subsp.
japonica GN=OSJNBa0053E05.7 PE=4 SV=1
Length = 1136

Score = 101 bits (252), Expect(2) = 2e-28
Identities = 45/105 (42%), Positives = 71/105 (67%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+++R +YFLK+KS L FK++ +V Q + ++ LRSD GGEY++ F+ +C +
Sbjct: 385 DDYTRMIWVYFLKEKSAALEIFKKFKAMVENQSNRKIKVLRSDQGGEYISKEFEKYCENA 444

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI++Q T Y+ QQNGVAERKNRT+ + +ML G+ K++W +
Sbjct: 445 GIRRQLTAGYSAQQNGVAERKNRTINDMANSMLQDKGMPKSFWAE 489



Score = 47.4 bits (111), Expect(2) = 2e-28
Identities = 22/50 (44%), Positives = 28/50 (56%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K EAV TA Y+ N P P TP+ W+GK P + H++VFGC Y
Sbjct: 484 KSFWAEAVNTAVYILNRSPTKAVPNRTPFEAWYGKKPVIGHMRVFGCICY 533


>tr|Q9FWI2|Q9FWI2_ORYSJ Os10g0106900 protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0065H03.10 PE=4 SV=2
Length = 1350

Score = 101 bits (252), Expect(2) = 3e-28
Identities = 45/105 (42%), Positives = 71/105 (67%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+++R +YFLK+KS L FK++ +V Q + ++ LRSD GGEY++ F+ +C +
Sbjct: 467 DDYTRMIWVYFLKEKSAALEIFKKFKAMVENQSNRKIKVLRSDQGGEYISKEFEKYCENA 526

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI++Q T Y+ QQNGVAERKNRT+ + +ML G+ K++W +
Sbjct: 527 GIRRQLTAGYSAQQNGVAERKNRTINDMANSMLQDKGMPKSFWAE 571



Score = 47.0 bits (110), Expect(2) = 3e-28
Identities = 22/50 (44%), Positives = 28/50 (56%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K EAV TA Y+ N P P TP+ W+GK P + H++VFGC Y
Sbjct: 566 KSFWAEAVNTAIYILNRSPTKAVPNRTPFEAWYGKKPVIGHMRVFGCICY 615


>tr|A5AL21|A5AL21_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031870 PE=4 SV=1
Length = 1274

Score = 105 bits (261), Expect(2) = 3e-28
Identities = 45/105 (42%), Positives = 73/105 (69%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+ SR + +YFL+ K++ +FK++ V +Q ++ LR+D GGE+++N FK FC +E
Sbjct: 525 DDHSRMSWVYFLQSKAETFETFKKFKAFVEKQSGKCIKVLRTDRGGEFLSNDFKVFCEEE 584

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
G+ ++ T PY+P+QNGVAERKNRT+V +R+M+ LS +W +
Sbjct: 585 GLHRELTTPYSPEQNGVAERKNRTVVEMARSMMKAKNLSNHFWAE 629



Score = 43.5 bits (101), Expect(2) = 3e-28
Identities = 22/45 (48%), Positives = 26/45 (57%)
Frame = -1

Query: 156 EAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
E VATA YL N P TPY W+G+ P + HL+VFG AY
Sbjct: 629 EGVATAVYLLNISPTKAVLNRTPYEAWYGRKPWVSHLKVFGSVAY 673


>tr|Q2QLK1|Q2QLK1_ORYSJ Retrotransposon protein, putative,
unclassified OS=Oryza sativa subsp. japonica
GN=LOC_Os12g44200 PE=4 SV=1
Length = 1198

Score = 101 bits (252), Expect(2) = 3e-28
Identities = 45/105 (42%), Positives = 71/105 (67%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+++R +YFLK+KS L FK++ +V Q + ++ LRSD GGEY++ F+ +C +
Sbjct: 495 DDYTRMIWVYFLKEKSAALEIFKKFKAMVENQSNRKIKVLRSDQGGEYISKEFEKYCENA 554

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI++Q T Y+ QQNGVAERKNRT+ + +ML G+ K++W +
Sbjct: 555 GIRRQLTAGYSAQQNGVAERKNRTINDMANSMLQDKGMPKSFWAE 599



Score = 47.0 bits (110), Expect(2) = 3e-28
Identities = 22/50 (44%), Positives = 28/50 (56%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K EAV TA Y+ N P P TP+ W+GK P + H++VFGC Y
Sbjct: 594 KSFWAEAVNTAIYILNRSPTKAVPNRTPFEAWYGKKPVIGHMRVFGCICY 643


>tr|Q8W3A4|Q8W3A4_ORYSA Putative gag-pol polyprotein OS=Oryza sativa
GN=OSJNBa0013O08.17 PE=4 SV=1
Length = 1167

Score = 101 bits (252), Expect(2) = 3e-28
Identities = 45/105 (42%), Positives = 71/105 (67%)
Frame = -2

Query: 467 DNFSRYTTIYFLKQKSQVLSSFKEYCRLVVRQHDLPVQALRSDNGGEYVTNAFKNFCMDE 288
D+++R +YFLK+KS L FK++ +V Q + ++ LRSD GGEY++ F+ +C +
Sbjct: 418 DDYTRMIWVYFLKEKSAALEIFKKFKAMVENQSNRKIKVLRSDQGGEYISKEFEKYCENA 477

Query: 287 GIQQQFTVPYTPQQNGVAERKNRTLVAASRAMLLTAGLSKAYWGK 153
GI++Q T Y+ QQNGVAERKNRT+ + +ML G+ K++W +
Sbjct: 478 GIRRQLTAGYSAQQNGVAERKNRTINDMANSMLQDKGMPKSFWAE 522



Score = 47.0 bits (110), Expect(2) = 3e-28
Identities = 22/50 (44%), Positives = 28/50 (56%)
Frame = -1

Query: 171 KGILGEAVATAGYLQNCIPHAIDPQYTPYYHWFGKIPDLQHLQVFGCSAY 22
K EAV TA Y+ N P P TP+ W+GK P + H++VFGC Y
Sbjct: 517 KSFWAEAVNTAIYILNRSPTKAVPNRTPFEAWYGKKPVIGHMRVFGCICY 566