BP919606
Clone id YMU001_000127_A12
Library
Length 403
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_A12.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAGAAGCGTGAGTTTAAGCAATTCGGTATCTAGCATTCCTGGGCACATACCTTTAAGAAG
AACATGAGTGTATGAAACAAATTGGTGTACACATTGATGTAGGTTGTAAGTGGGTTCTTA
CTCTGGACGTGGCTTGAAAATACAAGAAAATCCGAACATCTCACACAGCAGACATCTGTC
TGGTCTCCCAGACTTCAACCCCTTGCATATGCTTGCGTGCAACAAACAGACGCTGCCCAC
CTGCATCAAGGTTTGTGATCTCATGCCCACCATGCCGTCTACTGTGTTCGACAAAATTCC
TTCGAAATGAAGTCTCCCAGTATTCTCTATCAGCCACATCCACTTCTGTTCCGGCAAGCG
GCACCTCTGACCATACCTCAAGATCGCTAGCCCGCGTACAAAA
■■Homology search results ■■ -
sp_hit_id Q4R6V5
Definition sp|Q4R6V5|CS036_MACFA Uncharacterized protein C19orf36 homolog OS=Macaca fascicularis
Align length 49
Score (bit) 30.4
E-value 2.8
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919606|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_A12.
(403 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q4R6V5|CS036_MACFA Uncharacterized protein C19orf36 homolog O... 30 2.8
sp|Q1ZYL8|CS036_HUMAN Uncharacterized protein C19orf36 OS=Homo s... 30 3.7
sp|A0JPQ9|CHID1_RAT Chitinase domain-containing protein 1 OS=Rat... 30 3.7
sp|Q922Q9|CHID1_MOUSE Chitinase domain-containing protein 1 OS=M... 30 3.7
sp|P97433|RGNEF_MOUSE Rho-guanine nucleotide exchange factor OS=... 30 3.7
sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens GN... 29 6.3
sp|Q4VZL0|YCF1_CUCSA Putative membrane protein ycf1 OS=Cucumis s... 29 6.3
sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus aurat... 29 6.3
sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus aurat... 29 6.3
sp|P07602|SAP_HUMAN Proactivator polypeptide OS=Homo sapiens GN=... 29 8.2

>sp|Q4R6V5|CS036_MACFA Uncharacterized protein C19orf36 homolog
OS=Macaca fascicularis GN=QtsA-17041 PE=2 SV=1
Length = 219

Score = 30.4 bits (67), Expect = 2.8
Identities = 18/49 (36%), Positives = 25/49 (51%)
Frame = +1

Query: 106 VSGFLLWTWLENTRKSEHLTQQTSVWSPRLQPLAYACVQQTDAAHLHQG 252
VSG LL W ++T K HL + +L +A A Q+ D L+QG
Sbjct: 48 VSGALLTDWSDDTMKELHLAIPAEITREKLDQVATAVYQRMD--QLYQG 94


>sp|Q1ZYL8|CS036_HUMAN Uncharacterized protein C19orf36 OS=Homo
sapiens GN=C19orf36 PE=2 SV=2
Length = 232

Score = 30.0 bits (66), Expect = 3.7
Identities = 18/49 (36%), Positives = 24/49 (48%)
Frame = +1

Query: 106 VSGFLLWTWLENTRKSEHLTQQTSVWSPRLQPLAYACVQQTDAAHLHQG 252
VSG LL W ++T K HL + +L +A A Q D L+QG
Sbjct: 48 VSGALLTDWSDDTMKELHLAIPAKITREKLDQVATAVYQMMD--QLYQG 94


>sp|A0JPQ9|CHID1_RAT Chitinase domain-containing protein 1 OS=Rattus
norvegicus GN=Chid1 PE=2 SV=2
Length = 393

Score = 30.0 bits (66), Expect = 3.7
Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
Frame = -1

Query: 340 DVADREYWETSFRRNFVEHSRRHGGHEIT---NLDAGGQRLFVARKHMQGVEVWETRQ 176
D R W++ +F E+ + GG + L + RL +AR+ GV +WE Q
Sbjct: 327 DHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQ 384


>sp|Q922Q9|CHID1_MOUSE Chitinase domain-containing protein 1 OS=Mus
musculus GN=Chid1 PE=2 SV=1
Length = 393

Score = 30.0 bits (66), Expect = 3.7
Identities = 17/58 (29%), Positives = 27/58 (46%), Gaps = 3/58 (5%)
Frame = -1

Query: 340 DVADREYWETSFRRNFVEHSRRHGGHEIT---NLDAGGQRLFVARKHMQGVEVWETRQ 176
D R W++ +F E+ + GG + L + RL +AR+ GV +WE Q
Sbjct: 327 DHRPRVVWDSQAAEHFFEYKKNRGGRHVVFYPTLKSLQVRLELARELGVGVSIWELGQ 384


>sp|P97433|RGNEF_MOUSE Rho-guanine nucleotide exchange factor OS=Mus
musculus GN=Rgnef PE=1 SV=1
Length = 1693

Score = 30.0 bits (66), Expect = 3.7
Identities = 22/74 (29%), Positives = 32/74 (43%), Gaps = 1/74 (1%)
Frame = +3

Query: 171 DICLVSQTSTPCI-CLRATNRRCPPASRFVISCPPCRLLCSTKFLRNEVSQYSLSATSTS 347
D L+ + S C C T++ C A PPC K+ +N+ S++
Sbjct: 669 DKTLLGKESLQCANCKANTHKGCKDA------VPPCTKKFQEKYNKNKPQSILGSSSVRD 722

Query: 348 VPASGTSDHTSRSL 389
VPA G S H S S+
Sbjct: 723 VPAPGLSLHPSSSM 736


>sp|O14709|ZN197_HUMAN Zinc finger protein 197 OS=Homo sapiens
GN=ZNF197 PE=2 SV=1
Length = 1029

Score = 29.3 bits (64), Expect = 6.3
Identities = 16/47 (34%), Positives = 24/47 (51%)
Frame = -1

Query: 310 SFRRNFVEHSRRHGGHEITNLDAGGQRLFVARKHMQGVEVWETRQMS 170
S RN +EH R H G + D G + F+ +K + G + TR+ S
Sbjct: 772 SSNRNLIEHKRIHSGEKPYECDECG-KCFILKKSLIGHQRIHTREKS 817


>sp|Q4VZL0|YCF1_CUCSA Putative membrane protein ycf1 OS=Cucumis
sativus GN=ycf1-A PE=3 SV=2
Length = 1879

Score = 29.3 bits (64), Expect = 6.3
Identities = 30/94 (31%), Positives = 43/94 (45%), Gaps = 2/94 (2%)
Frame = +3

Query: 105 CKWVLTLDVA*KYKKIRTS--HTADICLVSQTSTPCICLRATNRRCPPASRFVISCPPCR 278
CK V+ L K KKI TS + + TSTP +T P ++ + P
Sbjct: 571 CKRVVILSDLNKIKKISTSTPTSTPTSTPTSTSTPTSTPTSTPTSTPTSTS---TSTPAS 627

Query: 279 LLCSTKFLRNEVSQYSLSATSTSVPASGTSDHTS 380
+ ST + + ++TSTS+PAS TS TS
Sbjct: 628 IPASTS---TSIPASTSTSTSTSIPAS-TSTSTS 657


>sp|P33264|CP2CR_MESAU Cytochrome P450 2C27 OS=Mesocricetus auratus
GN=CYP2C27 PE=2 SV=1
Length = 490

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
Frame = +3

Query: 177 CLVSQTSTPCICLRATNRR-CPPASRFVISCPPCRLLCSTKF 299
CLV + LR TN C P F++SC PC ++CS F
Sbjct: 151 CLVEE-------LRKTNGSPCDPT--FILSCAPCNVICSIIF 183


>sp|Q08078|CP2CP_MESAU Cytochrome P450 2C25 OS=Mesocricetus auratus
GN=CYP2C25 PE=2 SV=1
Length = 490

Score = 29.3 bits (64), Expect = 6.3
Identities = 17/42 (40%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
Frame = +3

Query: 177 CLVSQTSTPCICLRATNRR-CPPASRFVISCPPCRLLCSTKF 299
CLV + LR TN C P F++SC PC ++CS F
Sbjct: 151 CLVEE-------LRKTNGSPCDPT--FILSCAPCNVICSIIF 183


>sp|P07602|SAP_HUMAN Proactivator polypeptide OS=Homo sapiens
GN=PSAP PE=1 SV=2
Length = 524

Score = 28.9 bits (63), Expect = 8.2
Identities = 15/34 (44%), Positives = 19/34 (55%), Gaps = 4/34 (11%)
Frame = -1

Query: 361 PLAGTEVDVADREYW----ETSFRRNFVEHSRRH 272
PL GTE + YW ET+ + N VEH +RH
Sbjct: 488 PLLGTEKCIWGPSYWCQNTETAAQCNAVEHCKRH 521


tr_hit_id B8LKP6
Definition tr|B8LKP6|B8LKP6_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 75
Score (bit) 94.0
E-value 3.0e-18
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919606|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_A12.
(403 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LKP6|B8LKP6_PICSI Putative uncharacterized protein OS=Picea... 94 3e-18
tr|A9RGW0|A9RGW0_PHYPA Predicted protein OS=Physcomitrella paten... 83 6e-15
tr|Q2HUH9|Q2HUH9_MEDTR K+ channel tetramerisation OS=Medicago tr... 53 7e-06
tr|Q9S7R7|Q9S7R7_ARATH T16O11.1 protein (At3g09030) (MZB10.6 pro... 53 9e-06
tr|A5A8D3|A5A8D3_TOBAC Putative uncharacterized protein JEI1 OS=... 53 9e-06
tr|A7PP21|A7PP21_VITVI Chromosome chr8 scaffold_23, whole genome... 51 3e-05
tr|Q9FN67|Q9FN67_ARATH Gb|AAD56319.1 (Putative uncharacterized p... 49 1e-04
tr|Q0WL39|Q0WL39_ARATH Putative uncharacterized protein At5g4133... 49 1e-04
tr|Q84QB5|Q84QB5_ORYSJ Os03g0264700 protein OS=Oryza sativa subs... 48 3e-04
tr|A2XEU4|A2XEU4_ORYSI Putative uncharacterized protein OS=Oryza... 47 4e-04
tr|A3AGC1|A3AGC1_ORYSJ Putative uncharacterized protein OS=Oryza... 45 0.002
tr|B2B3X3|B2B3X3_PODAN Predicted CDS Pa_6_7540 OS=Podospora anse... 35 1.9
tr|B0JK64|B0JK64_MICAN Phosphotransacetylase OS=Microcystis aeru... 35 2.5
tr|B6TDA2|B6TDA2_MAIZE Protein binding protein OS=Zea mays PE=2 ... 35 2.5
tr|B3NE15|B3NE15_DROER GG16072 OS=Drosophila erecta GN=GG16072 P... 35 2.5
tr|B6PKV6|B6PKV6_BRAFL Putative uncharacterized protein OS=Branc... 34 3.1
tr|B1WT44|B1WT44_CYAA5 Probable fatty acid desaturase OS=Cyanoth... 34 4.2
tr|Q7F268|Q7F268_ORYSJ Os07g0419200 protein OS=Oryza sativa subs... 34 4.2
tr|A3BJ06|A3BJ06_ORYSJ Putative uncharacterized protein OS=Oryza... 34 4.2
tr|A2XVE6|A2XVE6_ORYSI Putative uncharacterized protein OS=Oryza... 34 4.2
tr|B6KXK3|B6KXK3_BRAFL Putative uncharacterized protein OS=Branc... 33 5.4
tr|A9RAZ0|A9RAZ0_PHYPA Predicted protein OS=Physcomitrella paten... 33 5.5
tr|A9SYW5|A9SYW5_PHYPA Predicted protein OS=Physcomitrella paten... 33 7.2
tr|Q8X0N9|Q8X0N9_NEUCR Related to nitrate assimilation regulator... 33 9.4

>tr|B8LKP6|B8LKP6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 464

Score = 94.0 bits (232), Expect = 3e-18
Identities = 48/75 (64%), Positives = 55/75 (73%)
Frame = -1

Query: 403 FCTRASDLEVWSEVPLAGTEVDVADREYWETSFRRNFVEHSRRHGGHEITNLDAGGQRLF 224
FC+R DLEVWSEVP+ + + E E FRRNFVEHSRR GH+IT+L AGG RLF
Sbjct: 395 FCSRGEDLEVWSEVPV----ISKSSAEVEEKKFRRNFVEHSRR--GHQITSLSAGGDRLF 448

Query: 223 VARKHMQGVEVWETR 179
VAR MQGVEVWET+
Sbjct: 449 VARWEMQGVEVWETK 463


>tr|A9RGW0|A9RGW0_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_104545 PE=4 SV=1
Length = 455

Score = 83.2 bits (204), Expect = 6e-15
Identities = 41/72 (56%), Positives = 54/72 (75%)
Frame = -1

Query: 397 TRASDLEVWSEVPLAGTEVDVADREYWETSFRRNFVEHSRRHGGHEITNLDAGGQRLFVA 218
++ +D+EVWSEVPLA + ++E+ E+SFRRN +EH RRH G EIT + AGG RLF+
Sbjct: 384 SQGADVEVWSEVPLAESFRPKEEKEFSESSFRRNRLEH-RRHPGQEITQMVAGGGRLFIT 442

Query: 217 RKHMQGVEVWET 182
RK QGVEVWE+
Sbjct: 443 RKDFQGVEVWES 454


>tr|Q2HUH9|Q2HUH9_MEDTR K+ channel tetramerisation OS=Medicago
truncatula GN=MtrDRAFT_AC149134g11v2 PE=4 SV=1
Length = 478

Score = 53.1 bits (126), Expect = 7e-06
Identities = 29/75 (38%), Positives = 41/75 (54%), Gaps = 1/75 (1%)
Frame = -1

Query: 403 FCTRASDLEVWSEVPLAGTEVDVADREY-WETSFRRNFVEHSRRHGGHEITNLDAGGQRL 227
F R +LEVWS V DRE E +RRNFV+ I ++ GG RL
Sbjct: 394 FVGRGGELEVWSRVKEVVECESERDRESDGEGVYRRNFVDKREDSEKGVIVKIEGGGDRL 453

Query: 226 FVARKHMQGVEVWET 182
F++R+ ++G+EVWE+
Sbjct: 454 FISREDVEGIEVWES 468


>tr|Q9S7R7|Q9S7R7_ARATH T16O11.1 protein (At3g09030) (MZB10.6
protein) OS=Arabidopsis thaliana GN=MZB10.6 PE=2 SV=1
Length = 460

Score = 52.8 bits (125), Expect = 9e-06
Identities = 31/77 (40%), Positives = 41/77 (53%)
Frame = -1

Query: 394 RASDLEVWSEVPLAGTEVDVADREYWETSFRRNFVEHSRRHGGHEITNLDAGGQRLFVAR 215
R LEVWS V ++ + RRNFV+ I+ ++AGG RLFV+R
Sbjct: 389 RGGALEVWSSVK---------EKTSGDPIRRRNFVDKEDDSKRGMISKIEAGGDRLFVSR 439

Query: 214 KHMQGVEVWETRQMSAV 164
+ M+GVEVWET S V
Sbjct: 440 ECMEGVEVWETSSFSGV 456


>tr|A5A8D3|A5A8D3_TOBAC Putative uncharacterized protein JEI1
OS=Nicotiana tabacum GN=JEI1 PE=2 SV=1
Length = 463

Score = 52.8 bits (125), Expect = 9e-06
Identities = 27/74 (36%), Positives = 45/74 (60%)
Frame = -1

Query: 403 FCTRASDLEVWSEVPLAGTEVDVADREYWETSFRRNFVEHSRRHGGHEITNLDAGGQRLF 224
FC++ +LE+WSEV + + + DR FR+N + ++ G++IT+ GG ++F
Sbjct: 393 FCSKGGNLELWSEVLIGNS---IKDRV-----FRKNSMGRAKDICGNKITHFSFGGNKMF 444

Query: 223 VARKHMQGVEVWET 182
V RK Q VEVW++
Sbjct: 445 VTRKDQQFVEVWQS 458


>tr|A7PP21|A7PP21_VITVI Chromosome chr8 scaffold_23, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00021480001
PE=4 SV=1
Length = 467

Score = 51.2 bits (121), Expect = 3e-05
Identities = 29/80 (36%), Positives = 43/80 (53%), Gaps = 2/80 (2%)
Frame = -1

Query: 403 FCTRASDLEVWSEVPLAGTEVDVADREYW--ETSFRRNFVEHSRRHGGHEITNLDAGGQR 230
F R LEVWS+ +RE E S+RRN+V+ IT ++ GG R
Sbjct: 393 FVARGGGLEVWSQ-----------ERENMVSEGSYRRNYVDKLDDLERGTITKMEGGGDR 441

Query: 229 LFVARKHMQGVEVWETRQMS 170
LF++R+ ++G+EVWE+ S
Sbjct: 442 LFISREDVEGIEVWESSNFS 461


>tr|Q9FN67|Q9FN67_ARATH Gb|AAD56319.1 (Putative uncharacterized
protein At5g41330) (At5g41330) OS=Arabidopsis thaliana
GN=At5g41330 PE=2 SV=1
Length = 458

Score = 49.3 bits (116), Expect = 1e-04
Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
Frame = -1

Query: 403 FCT-RASDLEVWSEVPLAGTEVDVADREYWETSFRRNFVEHSRRHGGHEITNLDAGGQRL 227
FC+ + S +E+WSEV + G + + E FR+N + G ++IT L GG R+
Sbjct: 378 FCSSKGSGIELWSEV-ITGLVGNASRDVLEERVFRKNSLGKLADSGENKITGLAFGGNRM 436

Query: 226 FVARKHMQGVEVWET 182
FV RK Q V+VW++
Sbjct: 437 FVTRKDQQSVQVWQS 451


>tr|Q0WL39|Q0WL39_ARATH Putative uncharacterized protein At5g41330
OS=Arabidopsis thaliana GN=At5g41330 PE=2 SV=1
Length = 458

Score = 49.3 bits (116), Expect = 1e-04
Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
Frame = -1

Query: 403 FCT-RASDLEVWSEVPLAGTEVDVADREYWETSFRRNFVEHSRRHGGHEITNLDAGGQRL 227
FC+ + S +E+WSEV + G + + E FR+N + G ++IT L GG R+
Sbjct: 378 FCSSKGSGIELWSEV-ITGLVGNASRDVLEERVFRKNSLGKLADSGENKITGLAFGGNRM 436

Query: 226 FVARKHMQGVEVWET 182
FV RK Q V+VW++
Sbjct: 437 FVTRKDQQSVQVWQS 451


>tr|Q84QB5|Q84QB5_ORYSJ Os03g0264700 protein OS=Oryza sativa subsp.
japonica GN=OJ1012B02.6 PE=4 SV=1
Length = 481

Score = 47.8 bits (112), Expect = 3e-04
Identities = 32/89 (35%), Positives = 44/89 (49%), Gaps = 11/89 (12%)
Frame = -1

Query: 403 FCTRASDLEVWS--EVPLAGT---------EVDVADREYWETSFRRNFVEHSRRHGGHEI 257
F +R LEVWS E GT + ++ + E FR +V+ I
Sbjct: 381 FVSRKDGLEVWSRLEEQSNGTANLAEQTRAKENINNEGINENCFRSCYVDTEEDADRGMI 440

Query: 256 TNLDAGGQRLFVARKHMQGVEVWETRQMS 170
++ GG RLFV R+ MQGVEVWET Q++
Sbjct: 441 HIMEGGGDRLFVTREEMQGVEVWETSQLA 469


>tr|A2XEU4|A2XEU4_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10858 PE=4 SV=1
Length = 481

Score = 47.4 bits (111), Expect = 4e-04
Identities = 32/89 (35%), Positives = 43/89 (48%), Gaps = 11/89 (12%)
Frame = -1

Query: 403 FCTRASDLEVWS--EVPLAGT---------EVDVADREYWETSFRRNFVEHSRRHGGHEI 257
F +R LEVWS E GT + ++ E FR +V+ I
Sbjct: 381 FVSRKDGLEVWSRLEEQSNGTANLAEQTRAKENINSEGINENCFRSCYVDTEEDADRGMI 440

Query: 256 TNLDAGGQRLFVARKHMQGVEVWETRQMS 170
++ GG RLFV R+ MQGVEVWET Q++
Sbjct: 441 HIMEGGGDRLFVTREEMQGVEVWETSQLA 469