BP919624
Clone id YMU001_000127_C07
Library
Length 538
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_C07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AGCCCGTGTGAAGGCATTGCAAGGCTGAAAAGGAGGCAAGCATGATAATTCCAGAAGTCA
AAATGCATGCAAAAGCTTCTCCGAGCCCTTGAATGGAGGCTTACATCGATGGACCATTAC
AGAGGCCAGACTCATGCATCCGTATTTGCAGTCTTTAAGATGTGCAATGTGGGGGTGGAT
TTATTTGCATGATTGGTGATATCAGAGAAGCTCTTATTTCTGCAAGATGAGATCAAAAGA
GAGTCTTTGCTCTGGAATTTCTCGATTAAGCATTTGGCGGTCACATGTTTGATGGAACGG
CCAAATTATTATTGATATAGAGAAGCGCTATTCATCTCTCTGATGAGGCACTTGAAGGTG
TATCTGGTGGAACTTTTGTTATTTACTACCATAGGATGATCATAATAAATGGAAACAGAT
TAAGGTATGATGTATTAGCATCACACATTATCCAGCCAAGTAGACAAATGGCAAGGCAGT
CAAAGTCAATACATGTTACACAGTGACAATTCTCTTTTGGCTTTTAGCCAACTTCAAC
■■Homology search results ■■ -
sp_hit_id Q5ZL42
Definition sp|Q5ZL42|BZW2_CHICK Basic leucine zipper and W2 domain-containing protein 2 OS=Gallus gallus
Align length 66
Score (bit) 31.2
E-value 3.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919624|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_C07.
(538 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q5ZL42|BZW2_CHICK Basic leucine zipper and W2 domain-containi... 31 3.4
sp|Q2L4X1|BZW2_MUSMM Basic leucine zipper and W2 domain-containi... 30 5.7
sp|Q91VK1|BZW2_MOUSE Basic leucine zipper and W2 domain-containi... 30 5.7
sp|Q4R6R4|BZW2_MACFA Basic leucine zipper and W2 domain-containi... 30 5.7
sp|Q9Y6E2|BZW2_HUMAN Basic leucine zipper and W2 domain-containi... 30 5.7
sp|Q5RDQ2|MPP5_PONAB MAGUK p55 subfamily member 5 OS=Pongo abeli... 30 7.4
sp|Q9WTT7|BZW2_RAT Basic leucine zipper and W2 domain-containing... 30 7.5
sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapien... 30 9.7

>sp|Q5ZL42|BZW2_CHICK Basic leucine zipper and W2 domain-containing
protein 2 OS=Gallus gallus GN=BZW2 PE=2 SV=1
Length = 414

Score = 31.2 bits (69), Expect = 3.4
Identities = 20/66 (30%), Positives = 35/66 (53%)
Frame = +1

Query: 199 ISEKLLFLQDEIKRESLLWNFSIKHLAVTCLMERPNYY*YREALFISLMRHLKVYLVELL 378
I E +L++++E+KR L ++ L TC+M + E + ++HLK Y L
Sbjct: 272 IKEMVLYVKEEMKRNELP-EPAVIGLLWTCVMNAVEWNKKEELVAEQALKHLKQYAPLLA 330

Query: 379 LFTTIG 396
+F+T G
Sbjct: 331 VFSTQG 336


>sp|Q2L4X1|BZW2_MUSMM Basic leucine zipper and W2 domain-containing
protein 2 OS=Mus musculus molossinus GN=Bzw2 PE=2 SV=1
Length = 419

Score = 30.4 bits (67), Expect = 5.7
Identities = 19/66 (28%), Positives = 35/66 (53%)
Frame = +1

Query: 199 ISEKLLFLQDEIKRESLLWNFSIKHLAVTCLMERPNYY*YREALFISLMRHLKVYLVELL 378
I E +L++++E+KR L ++ L TC+M + E + ++HLK Y L
Sbjct: 272 IKEVVLYVKEEMKRNDLP-ETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLA 330

Query: 379 LFTTIG 396
+F++ G
Sbjct: 331 VFSSQG 336


>sp|Q91VK1|BZW2_MOUSE Basic leucine zipper and W2 domain-containing
protein 2 OS=Mus musculus GN=Bzw2 PE=1 SV=1
Length = 419

Score = 30.4 bits (67), Expect = 5.7
Identities = 19/66 (28%), Positives = 35/66 (53%)
Frame = +1

Query: 199 ISEKLLFLQDEIKRESLLWNFSIKHLAVTCLMERPNYY*YREALFISLMRHLKVYLVELL 378
I E +L++++E+KR L ++ L TC+M + E + ++HLK Y L
Sbjct: 272 IKEVVLYVKEEMKRNDLP-ETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLA 330

Query: 379 LFTTIG 396
+F++ G
Sbjct: 331 VFSSQG 336


>sp|Q4R6R4|BZW2_MACFA Basic leucine zipper and W2 domain-containing
protein 2 OS=Macaca fascicularis GN=BZW2 PE=2 SV=1
Length = 419

Score = 30.4 bits (67), Expect = 5.7
Identities = 19/66 (28%), Positives = 35/66 (53%)
Frame = +1

Query: 199 ISEKLLFLQDEIKRESLLWNFSIKHLAVTCLMERPNYY*YREALFISLMRHLKVYLVELL 378
I E +L++++E+KR L ++ L TC+M + E + ++HLK Y L
Sbjct: 272 IKEVVLYVKEEMKRNDLP-ETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLA 330

Query: 379 LFTTIG 396
+F++ G
Sbjct: 331 VFSSQG 336


>sp|Q9Y6E2|BZW2_HUMAN Basic leucine zipper and W2 domain-containing
protein 2 OS=Homo sapiens GN=BZW2 PE=1 SV=1
Length = 419

Score = 30.4 bits (67), Expect = 5.7
Identities = 19/66 (28%), Positives = 35/66 (53%)
Frame = +1

Query: 199 ISEKLLFLQDEIKRESLLWNFSIKHLAVTCLMERPNYY*YREALFISLMRHLKVYLVELL 378
I E +L++++E+KR L ++ L TC+M + E + ++HLK Y L
Sbjct: 272 IKEVVLYVKEEMKRNDLP-ETAVIGLLWTCIMNAVEWNKKEELVAEQALKHLKQYAPLLA 330

Query: 379 LFTTIG 396
+F++ G
Sbjct: 331 VFSSQG 336


>sp|Q5RDQ2|MPP5_PONAB MAGUK p55 subfamily member 5 OS=Pongo abelii
GN=MPP5 PE=2 SV=1
Length = 675

Score = 30.0 bits (66), Expect = 7.4
Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 7/57 (12%)
Frame = -3

Query: 296 SIKHVTAKCLIEKFQSKDSLLISSCRNKSFSD-------ITNHANKSTPTLHILKTA 147
S+KH+ + + Q SLL+ +NK F + IT H NK++P ++ A
Sbjct: 130 SLKHIQHTLIDSQSQEDISLLLQLVQNKGFQNAFKIHNAITVHMNKASPPFPLISNA 186


>sp|Q9WTT7|BZW2_RAT Basic leucine zipper and W2 domain-containing
protein 2 OS=Rattus norvegicus GN=Bzw2 PE=2 SV=1
Length = 419

Score = 30.0 bits (66), Expect = 7.5
Identities = 19/66 (28%), Positives = 35/66 (53%)
Frame = +1

Query: 199 ISEKLLFLQDEIKRESLLWNFSIKHLAVTCLMERPNYY*YREALFISLMRHLKVYLVELL 378
I E +L++++E+KR L ++ L TC+M + E + ++HLK Y L
Sbjct: 272 IKEVVLYVKEEMKRNDLP-ETAVIGLLWTCVMNAVEWNKKEELVAEQALKHLKQYAPLLA 330

Query: 379 LFTTIG 396
+F++ G
Sbjct: 331 VFSSQG 336


>sp|Q8N3R9|MPP5_HUMAN MAGUK p55 subfamily member 5 OS=Homo sapiens
GN=MPP5 PE=1 SV=3
Length = 675

Score = 29.6 bits (65), Expect = 9.7
Identities = 17/57 (29%), Positives = 28/57 (49%), Gaps = 7/57 (12%)
Frame = -3

Query: 296 SIKHVTAKCLIEKFQSKDSLLISSCRNKSFSD-------ITNHANKSTPTLHILKTA 147
S+KH+ + + Q SLL+ +NK F + IT H NK++P ++ A
Sbjct: 130 SLKHIQHTLVDSQSQEDISLLLQLVQNKDFQNAFKIHNAITVHMNKASPPFPLISNA 186


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919624|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_C07.
(538 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******