BP919654
Clone id YMU001_000127_F03
Library
Length 548
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_F03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TGATGGTGGGATCGTGTCGGCCATATTTATTACATCCATTGTCTCAGATATCAGAGACAG
AGGTCGCTTCTCCACAATAATGGAGCGCAAAACTGTCAAAGACAGCTGCTTAGCCGTTGA
TGCATCTAACCTTCTCCGCTGAAGAAATGCTAGCAGTGAAGGAACATCAGAGGAGCTAGC
TGCAAGAGCCTCCAAATCTAGATGAATTCTCCACATAATGCCATGTGCCTGGTCTAGGAT
GATGTCAGGGTTTGCATAAACCCAGCTGTCTCCATAAATGTTGTTTTCATCACTATTTAG
AACTTCATGCGAGTCTTCACGACTTGCGGATCCAATAGCAGCAAACCCCAAATGCCCTCT
GAGCAACAGGGGAAGGGGAGCAGAAATTGGGGCCTTCATATCCATAAAGATATCATATAG
CAGCACAACTTTAGATGTTAACCGATGAACTAAAAGAACCCCATCCACGACACTAAATGC
CACACTCTCTGAATAGACTGGCAGCATTCCCTGAGGAACCACAGCATTGCGATAGAACCT
GTATATAC
■■Homology search results ■■ -
sp_hit_id Q96DM3
Definition sp|Q96DM3|MIC1_HUMAN Uncharacterized protein C18orf8 OS=Homo sapiens
Align length 164
Score (bit) 46.6
E-value 8.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919654|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_F03.
(548 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96DM3|MIC1_HUMAN Uncharacterized protein C18orf8 OS=Homo sap... 47 8e-05
sp|Q8VC42|MIC1_MOUSE Uncharacterized protein C18orf8 homolog OS=... 45 2e-04
sp|P31420|OMBP_MANSE Ommochrome-binding protein OS=Manduca sexta... 30 5.9
sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces... 30 7.7
sp|Q12446|LAS17_YEAST Proline-rich protein LAS17 OS=Saccharomyce... 30 7.7

>sp|Q96DM3|MIC1_HUMAN Uncharacterized protein C18orf8 OS=Homo
sapiens GN=C18orf8 PE=1 SV=2
Length = 657

Score = 46.6 bits (109), Expect = 8e-05
Identities = 39/164 (23%), Positives = 74/164 (45%), Gaps = 12/164 (7%)
Frame = -3

Query: 480 AFSVVDGVLLVHRLTSKVVLLYDIFM--DMKAPISAPLPLLLRGHL--------GFAAIG 331
A +VVD +++VH ++ +++DI + + ++ P+L + G AA+
Sbjct: 267 ALNVVDNLVVVHHQDTETSVIFDIKLRGEFDGSVTFHHPVLPARSIQPYQIPITGPAAVT 326

Query: 330 SASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEALAASSSDVPSLL 151
S S +Y SW+ PDII+ + G +W + + LE + D L+
Sbjct: 327 SQSPVPC---------KLYSSSWIVFQPDIIISASQGYLWNLQVKLEPIVNLLPDKGRLM 377

Query: 150 AFLQRRRLDASTAKQLSLTVLRSIIVE--KRPLSLISETMDVIN 25
FL +R+ K + L+V ++ E + L +I+ D +N
Sbjct: 378 DFLLQRK----ECKMVILSVCSQMLSESDRASLPVIATVFDKLN 417


>sp|Q8VC42|MIC1_MOUSE Uncharacterized protein C18orf8 homolog OS=Mus
musculus GN=Mic1 PE=2 SV=1
Length = 657

Score = 45.1 bits (105), Expect = 2e-04
Identities = 38/164 (23%), Positives = 74/164 (45%), Gaps = 12/164 (7%)
Frame = -3

Query: 480 AFSVVDGVLLVHRLTSKVVLLYDIFM--DMKAPISAPLPLLLRGHL--------GFAAIG 331
A +VVD +++VH ++ +++DI + + ++ P+L + G AA+
Sbjct: 267 ALNVVDNLVVVHHQDTETSVIFDIRLRGEFDGTVTFHHPVLPARSIQPYEIPLAGPAAVT 326

Query: 330 SASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEALAASSSDVPSLL 151
S S +Y SW+ PDII+ + G +W + + L+ + D L+
Sbjct: 327 SQSPVPC---------KLYSSSWIVFQPDIIISASQGYLWNLQVKLQPIVNLLPDKGRLM 377

Query: 150 AFLQRRRLDASTAKQLSLTVLRSIIVE--KRPLSLISETMDVIN 25
FL +R+ K + L+V ++ E + L +I+ D +N
Sbjct: 378 DFLLQRK----ECKAVVLSVCSQMLSESDRATLPVIATVFDKLN 417


>sp|P31420|OMBP_MANSE Ommochrome-binding protein OS=Manduca sexta
PE=1 SV=1
Length = 274

Score = 30.4 bits (67), Expect = 5.9
Identities = 25/89 (28%), Positives = 44/89 (49%), Gaps = 6/89 (6%)
Frame = -3

Query: 483 VAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPLLLRGHLGFAAIGSASREDSHE 304
V F+ G+ L + T+KV+ L D ++ S L +GF A+ A R+ +
Sbjct: 179 VFFANSSGIFLFNHHTNKVIDLGDYNVNAFTKDSKG-KLYFSSPVGFYAVNEADRKMNKL 237

Query: 303 VLNSDENNIYG------DSWVYANPDIIL 235
+ + E++I+G D+ VY+N D I+
Sbjct: 238 ISETGEDSIWGAAFDKDDNIVYSNEDNIV 266


>sp|P36029|TPO5_YEAST Polyamine transporter TPO5 OS=Saccharomyces
cerevisiae GN=TPO5 PE=1 SV=1
Length = 618

Score = 30.0 bits (66), Expect = 7.7
Identities = 30/107 (28%), Positives = 45/107 (42%), Gaps = 15/107 (14%)
Frame = -3

Query: 519 VPQGMLPVYSESVAFSVVDGVLLVHRL------------TSKVVLLYDIFMDM--KAPIS 382
+P+GM S +V S GV+ + + KV+ + +IF +S
Sbjct: 291 IPRGM----SNAVLLSAFSGVIFLIPIMLILPDNDLLFTNHKVLPIVNIFTKSTDSVVLS 346

Query: 381 APLPLLLRGHLGFAAIGSASREDSHEVLNSDENNI-YGDSWVYANPD 244
L LL+ G+L F+ IGS + S + I Y D W Y PD
Sbjct: 347 FFLVLLILGNLLFSGIGSITTSSRAVYSFSRDQAIPYYDKWTYVEPD 393


>sp|Q12446|LAS17_YEAST Proline-rich protein LAS17 OS=Saccharomyces
cerevisiae GN=LAS17 PE=1 SV=1
Length = 633

Score = 30.0 bits (66), Expect = 7.7
Identities = 11/25 (44%), Positives = 16/25 (64%)
Frame = +3

Query: 453 KEPHPRH*MPHSLNRLAAFPEEPQH 527
+E HP+H +P N+ A P+ PQH
Sbjct: 231 EETHPKHSLPPLPNQFAPLPDPPQH 255


tr_hit_id A9STH9
Definition tr|A9STH9|A9STH9_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 174
Score (bit) 205.0
E-value 1.0e-51
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919654|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_F03.
(548 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9STH9|A9STH9_PHYPA Predicted protein OS=Physcomitrella paten... 205 1e-51
tr|A7PVZ6|A7PVZ6_VITVI Chromosome chr8 scaffold_34, whole genome... 192 1e-47
tr|B8BGP8|B8BGP8_ORYSI Putative uncharacterized protein OS=Oryza... 182 8e-45
tr|Q9LHM0|Q9LHM0_ARATH Arabidopsis thaliana genomic DNA, chromos... 182 1e-44
tr|Q94I27|Q94I27_ORYSJ Putative Mic1 homolog OS=Oryza sativa sub... 180 4e-44
tr|Q338I5|Q338I5_ORYSJ Colon cancer-associated protein Mic1-like... 180 4e-44
tr|Q338I4|Q338I4_ORYSJ Colon cancer-associated protein Mic1-like... 180 4e-44
tr|Q0IXT3|Q0IXT3_ORYSJ Os10g0400900 protein (Fragment) OS=Oryza ... 180 4e-44
tr|A3C4I6|A3C4I6_ORYSJ Putative uncharacterized protein OS=Oryza... 180 4e-44
tr|A5B9A4|A5B9A4_VITVI Putative uncharacterized protein OS=Vitis... 174 4e-42
tr|Q9C7B8|Q9C7B8_ARATH Putative uncharacterized protein T21B14.1... 156 6e-37
tr|A7RLZ3|A7RLZ3_NEMVE Predicted protein OS=Nematostella vectens... 56 1e-06
tr|B7QG37|B7QG37_IXOSC Putative uncharacterized protein (Fragmen... 55 2e-06
tr|Q5PRA4|Q5PRA4_DANRE Zgc:101800 OS=Danio rerio GN=zgc:101800 P... 54 7e-06
tr|B6MKP4|B6MKP4_BRAFL Putative uncharacterized protein OS=Branc... 54 7e-06
tr|B4KVG4|B4KVG4_DROMO GI12100 OS=Drosophila mojavensis GN=GI121... 52 2e-05
tr|Q4T1N9|Q4T1N9_TETNG Chromosome undetermined SCAF10522, whole ... 52 3e-05
tr|B6MX43|B6MX43_BRAFL Putative uncharacterized protein OS=Branc... 51 3e-05
tr|B4MY06|B4MY06_DROWI GK11164 OS=Drosophila willistoni GN=GK111... 50 6e-05
tr|B3S193|B3S193_TRIAD Putative uncharacterized protein OS=Trich... 50 6e-05
tr|B0VZT4|B0VZT4_CULQU Putative uncharacterized protein OS=Culex... 50 6e-05
tr|B4LIA8|B4LIA8_DROVI GJ13375 OS=Drosophila virilis GN=GJ13375 ... 49 2e-04
tr|B4IXX3|B4IXX3_DROGR GH15161 OS=Drosophila grimshawi GN=GH1516... 49 2e-04
tr|Q9VRX1|Q9VRX1_DROME CG8270 OS=Drosophila melanogaster GN=CG82... 49 2e-04
tr|B4QJE5|B4QJE5_DROSI GD13958 OS=Drosophila simulans GN=GD13958... 49 2e-04
tr|B4PJP6|B4PJP6_DROYA GE21564 OS=Drosophila yakuba GN=GE21564 P... 48 3e-04
tr|B4HUU8|B4HUU8_DROSE GM14786 OS=Drosophila sechellia GN=GM1478... 48 4e-04
tr|Q5TX15|Q5TX15_ANOGA AGAP007576-PA OS=Anopheles gambiae GN=AGA... 47 5e-04
tr|Q29FH4|Q29FH4_DROPS GA20944 OS=Drosophila pseudoobscura pseud... 47 5e-04
tr|B4H1A9|B4H1A9_DROPE GL22580 OS=Drosophila persimilis GN=GL225... 47 5e-04

>tr|A9STH9|A9STH9_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_215592 PE=4 SV=1
Length = 680

Score = 205 bits (522), Expect = 1e-51
Identities = 104/174 (59%), Positives = 134/174 (77%), Gaps = 1/174 (0%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVVPQG LP++S VA SVVD VLLVH+ S+VVLLYDI D + PISAPLPL
Sbjct: 252 MYRFYRDAVVPQGSLPIFSSHVAISVVDNVLLVHQTDSQVVLLYDILTDPRGPISAPLPL 311

Query: 366 LLRGHLGFAAIGSASR-EDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLE 190
LLRG AA S++ + S L++ E IYG WV+ NPD++LD HG++WR+ LDLE
Sbjct: 312 LLRGAPSPAASSSSNTGKGSRRPLSTAEATIYGKGWVFINPDLVLDHMHGLLWRVRLDLE 371

Query: 189 ALAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
A+AASSS++PSLL+FLQRRR DA AK+LSL V++S+I+E+R L LI+ MDV+
Sbjct: 372 AVAASSSNLPSLLSFLQRRRFDAPKAKELSLIVIKSMIIERRSLRLIASAMDVV 425


>tr|A7PVZ6|A7PVZ6_VITVI Chromosome chr8 scaffold_34, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00025414001
PE=4 SV=1
Length = 806

Score = 192 bits (487), Expect = 1e-47
Identities = 98/182 (53%), Positives = 138/182 (75%), Gaps = 10/182 (5%)
Frame = -3

Query: 543 YRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPLL 364
YRFYR+AVV QG LP+YS+ +A SVVD VLLVH++ +KVV+LYDIF D +APISAPLPLL
Sbjct: 325 YRFYRDAVVQQGSLPIYSDKIAISVVDNVLLVHQVDAKVVILYDIFADSRAPISAPLPLL 384

Query: 363 LRGHLGFAAIGSASREDSHEVLNSDENN-------IYGDSWVYANPDIILDQAHGIMWRI 205
LRG A S+SR + + S+ N+ IYGD+W++ PD+I D A ++W+I
Sbjct: 385 LRGFP--RASSSSSRTGNKDTDGSEANDRSDHETIIYGDNWIFLVPDLICDVAKRLLWKI 442

Query: 204 HLDLE---ALAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMD 34
HLDLE A++ASSS+VPS+L FLQRR+L+A+ AKQL L ++R++I+E+RP+S+++ +D
Sbjct: 443 HLDLEASFAISASSSEVPSVLEFLQRRKLEANKAKQLCLAIVRTVILERRPVSMVTRAID 502

Query: 33 VI 28
V+
Sbjct: 503 VL 504


>tr|B8BGP8|B8BGP8_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_33485 PE=4 SV=1
Length = 720

Score = 182 bits (463), Expect = 8e-45
Identities = 88/173 (50%), Positives = 128/173 (73%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP YS +A S VD +++VH++ +KVV+LYD+FMD APISAPLPL
Sbjct: 250 LYRFYRDAVVQQGTLPTYSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPL 309

Query: 366 LLRGHLGFAAIGSASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEA 187
L+RG L SA DS ++ +YG+ W + PD++ D +G++W++HLDLEA
Sbjct: 310 LVRG-LPSNNKQSAQPPDSQS--SAYGGTLYGEGWSFLIPDLVCDVENGLLWKLHLDLEA 366

Query: 186 LAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
+AAS+SD PS+L FLQRR+ D S K LSL ++R+II+E+RP++++++ MDV+
Sbjct: 367 IAASTSDAPSILEFLQRRKSDPSMVKTLSLAIVRTIILERRPITMVAKAMDVV 419


>tr|Q9LHM0|Q9LHM0_ARATH Arabidopsis thaliana genomic DNA, chromosome
3, P1 clone: MEC18 OS=Arabidopsis thaliana PE=4 SV=1
Length = 769

Score = 182 bits (462), Expect = 1e-44
Identities = 90/176 (51%), Positives = 132/176 (75%), Gaps = 3/176 (1%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP+YS ++ +VVD +LLVH++ +KVV++YD+F+D +AP+SAPLPL
Sbjct: 330 LYRFYRDAVVQQGSLPIYSSKLSVNVVDNLLLVHQIDAKVVIIYDLFVDSRAPVSAPLPL 389

Query: 366 LLRGHLGFAAIGSASRED--SHEVLNSDENNI-YGDSWVYANPDIILDQAHGIMWRIHLD 196
L RG+ A ++ S E S+EN + Y D W + PD+ILDQ + ++W+IHLD
Sbjct: 390 LWRGYQVSETSSQAVNKEIESSESSTSNENIVMYEDGWTFLVPDLILDQTNKVLWKIHLD 449

Query: 195 LEALAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
LEA++ASSSD SLL FLQRR+L+A+ AKQL L + R+II+E+RP + +++ +DV+
Sbjct: 450 LEAISASSSDRTSLLEFLQRRKLEANKAKQLCLGIARAIILERRPATQVTQAIDVL 505


>tr|Q94I27|Q94I27_ORYSJ Putative Mic1 homolog OS=Oryza sativa subsp.
japonica GN=OSJNBa0050N08.24 PE=4 SV=1
Length = 801

Score = 180 bits (457), Expect = 4e-44
Identities = 87/173 (50%), Positives = 127/173 (73%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP YS +A S VD +++VH++ +KVV+LYD+FMD APISAPLPL
Sbjct: 331 LYRFYRDAVVQQGTLPTYSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPL 390

Query: 366 LLRGHLGFAAIGSASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEA 187
L+RG L SA DS ++ +YG+ W + PD++ D +G++W++HLDLEA
Sbjct: 391 LVRG-LPSNNKQSAQPPDSQS--SAYGGTLYGEGWSFLIPDLVCDVENGLLWKLHLDLEA 447

Query: 186 LAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
+AAS+SD P +L FLQRR+ D S K LSL ++R+II+E+RP++++++ MDV+
Sbjct: 448 IAASTSDAPLILEFLQRRKSDPSMVKTLSLAIVRTIILERRPITMVAKAMDVV 500


>tr|Q338I5|Q338I5_ORYSJ Colon cancer-associated protein Mic1-like
containing protein, expressed OS=Oryza sativa subsp.
japonica GN=LOC_Os10g26140 PE=4 SV=2
Length = 710

Score = 180 bits (457), Expect = 4e-44
Identities = 87/173 (50%), Positives = 127/173 (73%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP YS +A S VD +++VH++ +KVV+LYD+FMD APISAPLPL
Sbjct: 240 LYRFYRDAVVQQGTLPTYSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPL 299

Query: 366 LLRGHLGFAAIGSASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEA 187
L+RG L SA DS ++ +YG+ W + PD++ D +G++W++HLDLEA
Sbjct: 300 LVRG-LPSNNKQSAQPPDSQS--SAYGGTLYGEGWSFLIPDLVCDVENGLLWKLHLDLEA 356

Query: 186 LAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
+AAS+SD P +L FLQRR+ D S K LSL ++R+II+E+RP++++++ MDV+
Sbjct: 357 IAASTSDAPLILEFLQRRKSDPSMVKTLSLAIVRTIILERRPITMVAKAMDVV 409


>tr|Q338I4|Q338I4_ORYSJ Colon cancer-associated protein Mic1-like
containing protein, expressed OS=Oryza sativa subsp.
japonica GN=LOC_Os10g26140 PE=4 SV=2
Length = 726

Score = 180 bits (457), Expect = 4e-44
Identities = 87/173 (50%), Positives = 127/173 (73%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP YS +A S VD +++VH++ +KVV+LYD+FMD APISAPLPL
Sbjct: 240 LYRFYRDAVVQQGTLPTYSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPL 299

Query: 366 LLRGHLGFAAIGSASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEA 187
L+RG L SA DS ++ +YG+ W + PD++ D +G++W++HLDLEA
Sbjct: 300 LVRG-LPSNNKQSAQPPDSQS--SAYGGTLYGEGWSFLIPDLVCDVENGLLWKLHLDLEA 356

Query: 186 LAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
+AAS+SD P +L FLQRR+ D S K LSL ++R+II+E+RP++++++ MDV+
Sbjct: 357 IAASTSDAPLILEFLQRRKSDPSMVKTLSLAIVRTIILERRPITMVAKAMDVV 409


>tr|Q0IXT3|Q0IXT3_ORYSJ Os10g0400900 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os10g0400900 PE=4 SV=1
Length = 725

Score = 180 bits (457), Expect = 4e-44
Identities = 87/173 (50%), Positives = 127/173 (73%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP YS +A S VD +++VH++ +KVV+LYD+FMD APISAPLPL
Sbjct: 255 LYRFYRDAVVQQGTLPTYSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPL 314

Query: 366 LLRGHLGFAAIGSASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEA 187
L+RG L SA DS ++ +YG+ W + PD++ D +G++W++HLDLEA
Sbjct: 315 LVRG-LPSNNKQSAQPPDSQS--SAYGGTLYGEGWSFLIPDLVCDVENGLLWKLHLDLEA 371

Query: 186 LAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
+AAS+SD P +L FLQRR+ D S K LSL ++R+II+E+RP++++++ MDV+
Sbjct: 372 IAASTSDAPLILEFLQRRKSDPSMVKTLSLAIVRTIILERRPITMVAKAMDVV 424


>tr|A3C4I6|A3C4I6_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_030208 PE=4 SV=1
Length = 666

Score = 180 bits (457), Expect = 4e-44
Identities = 87/173 (50%), Positives = 127/173 (73%)
Frame = -3

Query: 546 IYRFYRNAVVPQGMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIFMDMKAPISAPLPL 367
+YRFYR+AVV QG LP YS +A S VD +++VH++ +KVV+LYD+FMD APISAPLPL
Sbjct: 196 LYRFYRDAVVQQGTLPTYSSRIAVSAVDNIIMVHQIDAKVVILYDVFMDSYAPISAPLPL 255

Query: 366 LLRGHLGFAAIGSASREDSHEVLNSDENNIYGDSWVYANPDIILDQAHGIMWRIHLDLEA 187
L+RG L SA DS ++ +YG+ W + PD++ D +G++W++HLDLEA
Sbjct: 256 LVRG-LPSNNKQSAQPPDSQS--SAYGGTLYGEGWSFLIPDLVCDVENGLLWKLHLDLEA 312

Query: 186 LAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLRSIIVEKRPLSLISETMDVI 28
+AAS+SD P +L FLQRR+ D S K LSL ++R+II+E+RP++++++ MDV+
Sbjct: 313 IAASTSDAPLILEFLQRRKSDPSMVKTLSLAIVRTIILERRPITMVAKAMDVV 365


>tr|A5B9A4|A5B9A4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_009872 PE=4 SV=1
Length = 763

Score = 174 bits (440), Expect = 4e-42
Identities = 95/199 (47%), Positives = 135/199 (67%), Gaps = 29/199 (14%)
Frame = -3

Query: 537 FYRNAVVPQ----------------GMLPVYSESVAFSVVDGVLLVHRLTSKVVLLYDIF 406
FYR+AVV Q G LP+YS+ +A SVVD VLLVH++ +KVV+LYDIF
Sbjct: 236 FYRDAVVQQVKILAQILSFILFHFKGSLPIYSDKIAISVVDNVLLVHQVDAKVVILYDIF 295

Query: 405 MDMKAPISAPLPLLLRGHLGFAAIGSASREDSHEVLNSDENN-------IYGDSWVYANP 247
D +APISAPLPLLLRG A S+SR + + S+ N+ IYGD+W++ P
Sbjct: 296 ADSRAPISAPLPLLLRGFP--RASSSSSRTGNKDTDGSEANDRSDHETIIYGDNWIFLVP 353

Query: 246 DIILDQAHGIMWRIHLDLE------ALAASSSDVPSLLAFLQRRRLDASTAKQLSLTVLR 85
D+I D A ++W+IHLDLE A++ASSS+VPS+L FLQRR+L+ + AKQL L ++R
Sbjct: 354 DLICDVAKRLLWKIHLDLEASFVGGAISASSSEVPSVLEFLQRRKLEXNKAKQLCLAIVR 413

Query: 84 SIIVEKRPLSLISETMDVI 28
++I+E+RP+S+++ +DV+
Sbjct: 414 TVILERRPVSMVTRAIDVL 432