BP919656
Clone id YMU001_000127_F05
Library
Length 435
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_F05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GCTAGCCCCCATAGCTTTTTAATGGCAACAGCTGTGCCATCTTGGAGAGTTCCTCTATAT
ACTGCCCCAGAACCACCAGTTGCAATTAGATTCTTTGAGCAAAAGTTTCTGGAACAGATG
TTCGGCTCATCCATTGTGAAAATTTTGGCCAGAGATTCGTCCCTTTCTACTGATATATTG
GAACAGCTACCCGAAAAAACCGGATCTAGTTCAATATCACAAAAAGATGCTACATTATGG
GATCGTTTGTAGATGTGATGTGGTTCTTTGTTTCTCAAACGCCTCCTCCAAAGGAGAATT
GTTGTAAATAATAGAGCTAGGAGAACTCCAATGCCTCCAATTATACTACTGACAATGATA
AGTAACGTTTCTACAATGCTTTTACTTGGTCTTGGAGAAGACTGATTAATTGCTTCTGAA
GGGTAACGGTTCATT
■■Homology search results ■■ -
sp_hit_id Q94F62
Definition sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated receptor kinase 1 OS=Arabidopsis thaliana
Align length 45
Score (bit) 49.3
E-value 7.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919656|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_F05.
(435 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated re... 49 7e-06
sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-l... 47 3e-05
sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase A... 45 1e-04
sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15 OS... 44 4e-04
sp|Q9M092|WAKLM_ARATH Wall-associated receptor kinase-like 17 OS... 44 4e-04
sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1 ... 44 4e-04
sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1 OS=Ar... 43 6e-04
sp|Q9LDT0|CRK30_ARATH Putative cysteine-rich receptor-like prote... 42 8e-04
sp|P0C5E2|Y1839_ARATH Putative serine/threonine-protein kinase A... 42 0.001
sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4 OS=... 42 0.001
sp|Q8LPB4|PSKR1_DAUCA Phytosulfokine receptor 1 OS=Daucus carota... 42 0.001
sp|Q9C9L5|WAKLH_ARATH Putative wall-associated receptor kinase-l... 41 0.002
sp|O65472|CRK12_ARATH Putative cysteine-rich receptor-like prote... 41 0.002
sp|Q8GYA4|CRK10_ARATH Cysteine-rich receptor-like protein kinase... 41 0.002
sp|Q9LMT9|WAKLL_ARATH Putative wall-associated receptor kinase-l... 40 0.003
sp|Q9S9M5|WAKLA_ARATH Wall-associated receptor kinase-like 1 OS=... 40 0.003
sp|Q9LN59|WAKLK_ARATH Putative wall-associated receptor kinase-l... 40 0.004
sp|Q7X8C5|WAKLB_ARATH Wall-associated receptor kinase-like 2 OS=... 40 0.005
sp|Q39191|WAK1_ARATH Wall-associated receptor kinase 1 OS=Arabid... 40 0.005
sp|Q9ZVR7|PSKR1_ARATH Phytosulfokine receptor 1 OS=Arabidopsis t... 40 0.005
sp|Q8LKZ1|NORK_PEA Nodulation receptor kinase OS=Pisum sativum G... 40 0.005
sp|Q0WNY5|WAKLN_ARATH Wall-associated receptor kinase-like 18 OS... 39 0.007
sp|Q9SA25|WAKLG_ARATH Wall-associated receptor kinase-like 8 OS=... 39 0.007
sp|Q6R2J8|SRF8_ARATH Protein STRUBBELIG-RECEPTOR FAMILY 8 OS=Ara... 39 0.007
sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1... 39 0.007
sp|Q8VYA3|WAKLJ_ARATH Wall-associated receptor kinase-like 10 OS... 39 0.009
sp|Q8RY17|WAKLI_ARATH Wall-associated receptor kinase-like 22 OS... 39 0.009
sp|Q9CAL2|CRK3_ARATH Cysteine-rich receptor-like protein kinase ... 39 0.009
sp|Q9LMN7|WAK5_ARATH Wall-associated receptor kinase 5 OS=Arabid... 39 0.012
sp|Q9LMN8|WAK3_ARATH Wall-associated receptor kinase 3 OS=Arabid... 39 0.012

>sp|Q94F62|BAK1_ARATH BRASSINOSTEROID INSENSITIVE 1-associated
receptor kinase 1 OS=Arabidopsis thaliana GN=BAK1 PE=1
SV=2
Length = 615

Score = 49.3 bits (116), Expect = 7e-06
Identities = 22/45 (48%), Positives = 31/45 (68%)
Frame = -2

Query: 146 KIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
K F++ E + S NF +KN++ GG G VY+G L DGT VA+K+L
Sbjct: 275 KRFSLRELQVASDNFSNKNILGRGGFGKVYKGRLADGTLVAVKRL 319


>sp|Q9LZM4|WAKLQ_ARATH Putative wall-associated receptor kinase-like
20 OS=Arabidopsis thaliana GN=WAKL20 PE=3 SV=1
Length = 657

Score = 47.0 bits (110), Expect = 3e-05
Identities = 27/63 (42%), Positives = 35/63 (55%), Gaps = 8/63 (12%)
Frame = -2

Query: 179 NISVERDESLA--------KIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVA 24
NI ER+E L+ +IFT E + NF NLI TGG G V++ L+DGT A
Sbjct: 330 NIVKEREEMLSANSTGKSSRIFTGREITKATNNFSKDNLIGTGGFGEVFKAVLEDGTITA 389

Query: 23 IKK 15
IK+
Sbjct: 390 IKR 392


>sp|Q3EDL4|Y1154_ARATH Putative serine/threonine-protein kinase
At1g01540 OS=Arabidopsis thaliana GN=At1g01540 PE=1 SV=2
Length = 472

Score = 45.1 bits (105), Expect = 1e-04
Identities = 20/43 (46%), Positives = 26/43 (60%)
Frame = -2

Query: 140 FTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
+T+ E + C +N+I GG G VYRG L DGT VA+K L
Sbjct: 142 YTLRELEAATNGLCEENVIGEGGYGIVYRGILTDGTKVAVKNL 184


>sp|Q9M342|WAKLP_ARATH Wall-associated receptor kinase-like 15
OS=Arabidopsis thaliana GN=WAKL15 PE=2 SV=2
Length = 639

Score = 43.5 bits (101), Expect = 4e-04
Identities = 21/46 (45%), Positives = 28/46 (60%)
Frame = -2

Query: 152 LAKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
L +IFT E + NF NL+ GG G V++G L DGT VA+K+
Sbjct: 338 LDRIFTGKEIVKATDNFAKSNLLGFGGFGEVFKGNLDDGTTVAVKR 383


>sp|Q9M092|WAKLM_ARATH Wall-associated receptor kinase-like 17
OS=Arabidopsis thaliana GN=WAKL17 PE=2 SV=2
Length = 786

Score = 43.5 bits (101), Expect = 4e-04
Identities = 20/45 (44%), Positives = 26/45 (57%)
Frame = -2

Query: 149 AKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
A+IFT E + NF ++ GG G VY+G L DG VA+KK
Sbjct: 429 ARIFTSKELEKATENFSENRVLGHGGQGTVYKGMLVDGRTVAVKK 473


>sp|Q9C7S5|PSYR1_ARATH Tyrosine-sulfated glycopeptide receptor 1
OS=Arabidopsis thaliana GN=PSYR1 PE=2 SV=1
Length = 1095

Score = 43.5 bits (101), Expect = 4e-04
Identities = 32/93 (34%), Positives = 46/93 (49%), Gaps = 12/93 (12%)
Frame = -2

Query: 248 KRSHNVASFCDIELDPVFSGSCSNI--SVERDESLAKIF----------TMDEPNICSRN 105
KR N + EL+ +GS S + ++D SL +F T+ E + N
Sbjct: 743 KRRVNPGDSENAELEINSNGSYSEVPPGSDKDISLVLLFGNSRYEVKDLTIFELLKATDN 802

Query: 104 FCSKNLIATGGSGAVYRGTLQDGTAVAIKKLWG 6
F N+I GG G VY+ TL +GT +A+KKL G
Sbjct: 803 FSQANIIGCGGFGLVYKATLDNGTKLAVKKLTG 835


>sp|P43298|TMK1_ARATH Putative receptor protein kinase TMK1
OS=Arabidopsis thaliana GN=TMK1 PE=1 SV=1
Length = 942

Score = 42.7 bits (99), Expect = 6e-04
Identities = 16/34 (47%), Positives = 25/34 (73%)
Frame = -2

Query: 113 SRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
+ NF S N++ +GG G VY+G L DGT +A+K++
Sbjct: 585 TNNFSSDNILGSGGFGVVYKGELHDGTKIAVKRM 618


>sp|Q9LDT0|CRK30_ARATH Putative cysteine-rich receptor-like protein
kinase 30 OS=Arabidopsis thaliana GN=CRK30 PE=2 SV=1
Length = 700

Score = 42.4 bits (98), Expect = 8e-04
Identities = 19/43 (44%), Positives = 27/43 (62%)
Frame = -2

Query: 140 FTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
F + + + NF + N I GG G VY+GTL +GT VA+K+L
Sbjct: 334 FDIKDIEAATSNFLASNKIGQGGFGEVYKGTLSNGTEVAVKRL 376


>sp|P0C5E2|Y1839_ARATH Putative serine/threonine-protein kinase
At1g18390 OS=Arabidopsis thaliana GN=At1g18390 PE=1 SV=1
Length = 605

Score = 42.0 bits (97), Expect = 0.001
Identities = 25/73 (34%), Positives = 38/73 (52%), Gaps = 3/73 (4%)
Frame = -2

Query: 218 DIELDPVFSGSCSNISVERDESL---AKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGT 48
+I DP S + +E+ E L IF+ +E + NF + GG G VY G
Sbjct: 258 NISSDP----SAKSFDIEKAEELLVGVHIFSYEELEEATNNFDPSKELGDGGFGTVYYGK 313

Query: 47 LQDGTAVAIKKLW 9
L+DG +VA+K+L+
Sbjct: 314 LKDGRSVAVKRLY 326


>sp|Q9S9M2|WAKLD_ARATH Wall-associated receptor kinase-like 4
OS=Arabidopsis thaliana GN=WAKL4 PE=2 SV=2
Length = 761

Score = 42.0 bits (97), Expect = 0.001
Identities = 19/51 (37%), Positives = 31/51 (60%)
Frame = -2

Query: 167 ERDESLAKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
E + ++KIF+ +E + NF + ++ GG G VY+G L DG VA+K+
Sbjct: 403 EGNVEMSKIFSSNELEKATDNFNTNRVLGQGGQGTVYKGMLVDGRIVAVKR 453


tr_hit_id B8AKD6
Definition tr|B8AKD6|B8AKD6_ORYSI Putative uncharacterized protein OS=Oryza sativa subsp. indica
Align length 53
Score (bit) 53.9
E-value 4.0e-06
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919656|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_F05.
(435 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8AKD6|B8AKD6_ORYSI Putative uncharacterized protein OS=Oryza... 54 4e-06
tr|Q84QB8|Q84QB8_ORYSJ Putative receptor ser/thr protein (Protei... 54 5e-06
tr|Q0DT84|Q0DT84_ORYSJ Os03g0264300 protein OS=Oryza sativa subs... 54 5e-06
tr|A3AGB8|A3AGB8_ORYSJ Putative uncharacterized protein OS=Oryza... 54 5e-06
tr|Q0PW22|Q0PW22_POPTO Leucine-rich repeat receptor-like kinase ... 52 1e-05
tr|B8AZK3|B8AZK3_ORYSI Putative uncharacterized protein OS=Oryza... 52 1e-05
tr|Q75KZ6|Q75KZ6_ORYSJ Putative receptor protein kinase OS=Oryza... 52 2e-05
tr|Q0DH82|Q0DH82_ORYSJ Os05g0486100 protein OS=Oryza sativa subs... 52 2e-05
tr|A3B599|A3B599_ORYSJ Putative uncharacterized protein OS=Oryza... 52 2e-05
tr|A7VM44|A7VM44_MARPO Receptor-like kinase OS=Marchantia polymo... 50 4e-05
tr|A7PNC8|A7PNC8_VITVI Chromosome chr1 scaffold_22, whole genome... 50 4e-05
tr|A7PFJ3|A7PFJ3_VITVI Chromosome chr11 scaffold_14, whole genom... 50 4e-05
tr|A5BQD1|A5BQD1_VITVI Putative uncharacterized protein OS=Vitis... 50 4e-05
tr|A5BAS3|A5BAS3_VITVI Putative uncharacterized protein OS=Vitis... 50 4e-05
tr|A7PAI1|A7PAI1_VITVI Chromosome chr14 scaffold_9, whole genome... 50 6e-05
tr|Q8GW09|Q8GW09_ARATH Putative uncharacterized protein At3g2670... 50 7e-05
tr|A5ACQ1|A5ACQ1_VITVI Putative uncharacterized protein OS=Vitis... 50 7e-05
tr|Q8RYK7|Q8RYK7_ORYSJ cDNA, clone: J075188E15, full insert sequ... 49 1e-04
tr|Q700L7|Q700L7_9POAL Receptor-like-kinase (Fragment) OS=Avena ... 49 1e-04
tr|Q38963|Q38963_ARATH Putative uncharacterized protein (Serine/... 49 1e-04
tr|Q1KUW2|Q1KUW2_9ROSI Putative uncharacterized protein OS=Cleom... 49 1e-04
tr|A7VM36|A7VM36_MARPO Receptor-like kinase OS=Marchantia polymo... 49 1e-04
tr|A5HU60|A5HU60_PANGI Somatic embryogenesis protein kinase 2 (F... 49 1e-04
tr|A2Y4U5|A2Y4U5_ORYSI Putative uncharacterized protein OS=Oryza... 49 1e-04
tr|A2WYN4|A2WYN4_ORYSI Putative uncharacterized protein OS=Oryza... 49 1e-04
tr|Q84Q68|Q84Q68_ORYSJ Protein kinase (Putative uncharacterized ... 49 1e-04
tr|Q10NG8|Q10NG8_ORYSJ Os03g0269300 protein OS=Oryza sativa subs... 49 1e-04
tr|B4FZP2|B4FZP2_MAIZE Putative uncharacterized protein OS=Zea m... 49 1e-04
tr|A7VM35|A7VM35_MARPO Receptor-like kinase OS=Marchantia polymo... 49 1e-04
tr|Q0DXX4|Q0DXX4_ORYSJ Os02g0728500 protein OS=Oryza sativa subs... 49 2e-04

>tr|B8AKD6|B8AKD6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_10854 PE=4 SV=1
Length = 437

Score = 53.9 bits (128), Expect = 4e-06
Identities = 25/53 (47%), Positives = 35/53 (66%)
Frame = -2

Query: 170 VERDESLAKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
+ R S ++F++ E + +RNF N I GG GAVY+G L+DGT +AIKKL
Sbjct: 78 ISRAGSNVRVFSLKELKLATRNFHMMNCIGRGGFGAVYKGNLKDGTQIAIKKL 130


>tr|Q84QB8|Q84QB8_ORYSJ Putative receptor ser/thr protein (Protein
kinase domain containing protein, expressed) OS=Oryza
sativa subsp. japonica GN=OJ1012B02.3 PE=4 SV=1
Length = 392

Score = 53.5 bits (127), Expect = 5e-06
Identities = 24/53 (45%), Positives = 35/53 (66%)
Frame = -2

Query: 170 VERDESLAKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
+ R S ++F++ E + +RNF N + GG GAVY+G L+DGT +AIKKL
Sbjct: 33 ISRAGSNVRVFSLKELKLATRNFHMMNCVGRGGFGAVYKGNLKDGTQIAIKKL 85


>tr|Q0DT84|Q0DT84_ORYSJ Os03g0264300 protein OS=Oryza sativa subsp.
japonica GN=Os03g0264300 PE=4 SV=1
Length = 347

Score = 53.5 bits (127), Expect = 5e-06
Identities = 24/53 (45%), Positives = 35/53 (66%)
Frame = -2

Query: 170 VERDESLAKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
+ R S ++F++ E + +RNF N + GG GAVY+G L+DGT +AIKKL
Sbjct: 33 ISRAGSNVRVFSLKELKLATRNFHMMNCVGRGGFGAVYKGNLKDGTQIAIKKL 85


>tr|A3AGB8|A3AGB8_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_009840 PE=4 SV=1
Length = 519

Score = 53.5 bits (127), Expect = 5e-06
Identities = 24/53 (45%), Positives = 35/53 (66%)
Frame = -2

Query: 170 VERDESLAKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKKL 12
+ R S ++F++ E + +RNF N + GG GAVY+G L+DGT +AIKKL
Sbjct: 160 ISRAGSNVRVFSLKELKLATRNFHMMNCVGRGGFGAVYKGNLKDGTQIAIKKL 212


>tr|Q0PW22|Q0PW22_POPTO Leucine-rich repeat receptor-like kinase
OS=Populus tomentosa GN=SERK1 PE=2 SV=1
Length = 622

Score = 52.4 bits (124), Expect = 1e-05
Identities = 30/80 (37%), Positives = 41/80 (51%)
Frame = -2

Query: 251 YKRSHNVASFCDIELDPVFSGSCSNISVERDESLAKIFTMDEPNICSRNFCSKNLIATGG 72
+++ HN F D+ S N+ + F E + + NF SKNLI GG
Sbjct: 262 WRQRHNQQIFFDVNEQHNEELSLGNL---------RSFQFKELQVATNNFSSKNLIGKGG 312

Query: 71 SGAVYRGTLQDGTAVAIKKL 12
G VY+G LQDGT VA+K+L
Sbjct: 313 FGNVYKGYLQDGTVVAVKRL 332


>tr|B8AZK3|B8AZK3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20397 PE=4 SV=1
Length = 972

Score = 52.0 bits (123), Expect = 1e-05
Identities = 24/45 (53%), Positives = 30/45 (66%)
Frame = -2

Query: 149 AKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
A+ F+ DE IC+ NF + I +GG G VYRG L DGT VAIK+
Sbjct: 616 ARFFSFDELKICTNNFSDNHEIGSGGYGKVYRGILGDGTCVAIKR 660


>tr|Q75KZ6|Q75KZ6_ORYSJ Putative receptor protein kinase OS=Oryza
sativa subsp. japonica GN=OJ1004_E02.6 PE=4 SV=1
Length = 909

Score = 51.6 bits (122), Expect = 2e-05
Identities = 24/45 (53%), Positives = 30/45 (66%)
Frame = -2

Query: 149 AKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
A+ F+ DE IC+ NF + I +GG G VYRG L DGT VAIK+
Sbjct: 556 ARFFSFDELKICTNNFSDNHEIGSGGYGKVYRGILGDGTRVAIKR 600


>tr|Q0DH82|Q0DH82_ORYSJ Os05g0486100 protein OS=Oryza sativa subsp.
japonica GN=Os05g0486100 PE=4 SV=1
Length = 969

Score = 51.6 bits (122), Expect = 2e-05
Identities = 24/45 (53%), Positives = 30/45 (66%)
Frame = -2

Query: 149 AKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
A+ F+ DE IC+ NF + I +GG G VYRG L DGT VAIK+
Sbjct: 616 ARFFSFDELKICTNNFSDNHEIGSGGYGKVYRGILGDGTRVAIKR 660


>tr|A3B599|A3B599_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_018221 PE=4 SV=1
Length = 945

Score = 51.6 bits (122), Expect = 2e-05
Identities = 24/45 (53%), Positives = 30/45 (66%)
Frame = -2

Query: 149 AKIFTMDEPNICSRNFCSKNLIATGGSGAVYRGTLQDGTAVAIKK 15
A+ F+ DE IC+ NF + I +GG G VYRG L DGT VAIK+
Sbjct: 592 ARFFSFDELKICTNNFSDNHEIGSGGYGKVYRGILGDGTRVAIKR 636


>tr|A7VM44|A7VM44_MARPO Receptor-like kinase OS=Marchantia
polymorpha GN=MpRLK28 PE=2 SV=1
Length = 626

Score = 50.4 bits (119), Expect = 4e-05
Identities = 32/85 (37%), Positives = 44/85 (51%), Gaps = 2/85 (2%)
Frame = -2

Query: 260 HHIYKRSHNVASFCDI--ELDPVFSGSCSNISVERDESLAKIFTMDEPNICSRNFCSKNL 87
+H +KR + +F D+ E DP E K F+ E I + NF SKN+
Sbjct: 254 YHKHKRLNRKENFFDVAAEDDP-----------EVPLGQLKKFSFRELQIATDNFSSKNI 302

Query: 86 IATGGSGAVYRGTLQDGTAVAIKKL 12
+ GG G VY+G L DGT VA+K+L
Sbjct: 303 LGQGGFGKVYKGYLSDGTTVAVKRL 327