BP919657
Clone id YMU001_000127_F06
Library
Length 573
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_F06.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATGCATTGAGGTCGACTCGACTCTTTAGCTTGGCACAATGGGCTGCCAAACGGGACCAAT
ATTATGGCGAACTTCTTATTGATTGCACCCTTATGATCGAATCTTGAGCTACCCTTGCCG
GCCAACGCCACCTATGCACTGGCCCTCCTCTTTACCACCTTTCAACTACTCACGGATAGC
AACTTTCCGAACCTGCAGGTGCCGCCCTCTGTAAACGGCAGGTCTACACGCCCTCAGAAG
GCCTCCTGCTCTTCACTCAGGCTTCTTGGTTTTGTACACGGCACCCCTCAGCACCCTTAA
AATCGGCTCTTCCTCCTCTTGTATCGCTCAGTGCTACTCTGTCCTGCTTCCTTCAGTCCC
TGTATGGTAGGCCACGGCCTTCATCTCTTGCCTCCCTAGTTTTGGCCTGCGCACAGCTGG
CTCTCGGCTTCCAGATGGCGCACCCAGAGGCTCTCCACCCCTGTCAGACAGCGTTGCTCC
CTCCTGAGTCCTGCATTTCGGCTTCACACTCCCCAAGGCTAGCGCCCCTTATCTCTCTGA
AGTTGGCGCCACTTTCTCCGTTCTTTCAAGTTT
■■Homology search results ■■ -
sp_hit_id Q00653
Definition sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=Homo sapiens
Align length 60
Score (bit) 32.3
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919657|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_F06.
(573 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit OS=... 32 1.7
sp|Q3UPL0|SC31A_MOUSE Protein transport protein Sec31A OS=Mus mu... 32 2.2
sp|Q96DN6|MBD6_HUMAN Methyl-CpG-binding domain protein 6 OS=Homo... 32 2.9
sp|A9MRW8|RNFC_SALAR Electron transport complex protein rnfC OS=... 31 3.9
sp|Q9WTK5|NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=... 30 6.5

>sp|Q00653|NFKB2_HUMAN Nuclear factor NF-kappa-B p100 subunit
OS=Homo sapiens GN=NFKB2 PE=1 SV=4
Length = 900

Score = 32.3 bits (72), Expect = 1.7
Identities = 23/60 (38%), Positives = 31/60 (51%), Gaps = 5/60 (8%)
Frame = +3

Query: 12 STRLFSLAQWAAKRDQYYGELLIDCTLMIES*ATLAGQRHLCT-----GPPLYHLSTTHG 176
+ RLF LAQ +A+ L+D + ++ A LAGQRHL T G HL+ HG
Sbjct: 447 NARLFGLAQRSARA-------LLDYGVTADARALLAGQRHLLTAQDENGDTPLHLAIIHG 499


>sp|Q3UPL0|SC31A_MOUSE Protein transport protein Sec31A OS=Mus
musculus GN=Sec31a PE=1 SV=2
Length = 1230

Score = 32.0 bits (71), Expect = 2.2
Identities = 36/124 (29%), Positives = 51/124 (41%), Gaps = 5/124 (4%)
Frame = +2

Query: 122 PTPPMHWPSSLPPFNYSRIATFRTCRCRPL*TAGLHALR-----RPPALHSGFLVLYTAP 286
PT P H PS LPP Y + ++ + T G A R PPA ++ Y +P
Sbjct: 857 PTAPGHMPSQLPP--YPQPQPYQPAQQYSFGTGGAAAYRPQQPVAPPASNAYPNTPYISP 914

Query: 287 LSTLKIGSSSSCIAQCYSVLLPSVPVW*ATAFISCLPSFGLRTAGSRLPDGAPRGSPPLS 466
+ +S S Q Y+ S P S SF ++G+ G P G+PP S
Sbjct: 915 V------ASYSGQPQMYTAQQASSPT------SSSAASFPPPSSGASFQHGGP-GAPPSS 961

Query: 467 DSVA 478
+ A
Sbjct: 962 SAYA 965


>sp|Q96DN6|MBD6_HUMAN Methyl-CpG-binding domain protein 6 OS=Homo
sapiens GN=MBD6 PE=2 SV=2
Length = 1003

Score = 31.6 bits (70), Expect = 2.9
Identities = 27/62 (43%), Positives = 29/62 (46%)
Frame = +3

Query: 366 GRPRPSSLASLVLACAQLALGFQMAHPEALHPCQTALLPPESCISASHSPRLAPLISLKL 545
G P P S AS LAC +L PEA PC LPPES SA P +S L
Sbjct: 782 GAPPPLSEASSPLACLLQSLQIPPEQPEA--PC----LPPESPASALEPEPARPPLS-AL 834

Query: 546 AP 551
AP
Sbjct: 835 AP 836


>sp|A9MRW8|RNFC_SALAR Electron transport complex protein rnfC
OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86
/ RSK2980) GN=rnfC PE=3 SV=1
Length = 673

Score = 31.2 bits (69), Expect = 3.9
Identities = 19/64 (29%), Positives = 30/64 (46%)
Frame = -1

Query: 561 TEKVAPTSER*GALALGSVKPKCRTQEGATLSDRGGEPLGAPSGSREPAVRRPKLGRQEM 382
+E P R A+ + K R QE +S+ EP+ + E A+ R K +QE
Sbjct: 577 SEAAEPVDPRKAAVEAAIARAKARKQEQQAVSE-AAEPVDPRKAAVEAAIARAKARKQEQ 635

Query: 381 KAVA 370
+AV+
Sbjct: 636 QAVS 639


>sp|Q9WTK5|NFKB2_MOUSE Nuclear factor NF-kappa-B p100 subunit OS=Mus
musculus GN=Nfkb2 PE=1 SV=1
Length = 899

Score = 30.4 bits (67), Expect = 6.5
Identities = 22/60 (36%), Positives = 30/60 (50%), Gaps = 5/60 (8%)
Frame = +3

Query: 12 STRLFSLAQWAAKRDQYYGELLIDCTLMIES*ATLAGQRHLC-----TGPPLYHLSTTHG 176
+ RLF LAQ +A+ L+D + ++ A LAGQRHL G HL+ HG
Sbjct: 447 NARLFGLAQRSARA-------LLDYGVTADARALLAGQRHLLMAQDENGDTPLHLAIIHG 499


tr_hit_id A5KAP2
Definition tr|A5KAP2|A5KAP2_PLAVI Putative uncharacterized protein OS=Plasmodium vivax
Align length 108
Score (bit) 37.4
E-value 0.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919657|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_F06.
(573 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5KAP2|A5KAP2_PLAVI Putative uncharacterized protein OS=Plasm... 37 0.60
tr|Q4T6U1|Q4T6U1_TETNG Chromosome 21 SCAF8611, whole genome shot... 36 1.3
tr|B1ZCQ6|B1ZCQ6_METPB Amidohydrolase OS=Methylobacterium populi... 34 6.6
tr|B7KWW0|B7KWW0_METCH Amidohydrolase OS=Methylobacterium chloro... 34 6.6
tr|A5G9E8|A5G9E8_GEOUR General secretory system II, protein E do... 33 8.6
tr|Q14395|Q14395_HUMAN Mucin (Fragment) OS=Homo sapiens PE=2 SV=1 33 8.6

>tr|A5KAP2|A5KAP2_PLAVI Putative uncharacterized protein OS=Plasmodium
vivax GN=PVX_000975 PE=4 SV=1
Length = 2628

Score = 37.4 bits (85), Expect = 0.60
Identities = 31/108 (28%), Positives = 47/108 (43%)
Frame = -3

Query: 565 KNGESGANFREIRGASLGECEAEMQDSGGSNAV*QGWRASGCAIWKPRASCAQAKTREAR 386
KNGESG+N R +R G +++ GGS + SG K + + + +R R
Sbjct: 1300 KNGESGSNSRRVRILGEGSPDSDNDSDGGSGS------GSGDDQKKEKNGESGSNSRRVR 1353

Query: 385 DEGRGLPYRD*RKQDRVALSDTRGGRADFKGAEGCRVQNQEA*VKSRR 242
G G P D +D+ GG G + + +N E+ SRR
Sbjct: 1354 ILGEGSPDSD---------NDSDGGSGSGSGDDQKKEKNGESGSNSRR 1392



Score = 37.0 bits (84), Expect = 0.78
Identities = 31/108 (28%), Positives = 46/108 (42%)
Frame = -3

Query: 565 KNGESGANFREIRGASLGECEAEMQDSGGSNAV*QGWRASGCAIWKPRASCAQAKTREAR 386
KNGESG+N R +R G + + GGS + SG K + + + +R R
Sbjct: 1259 KNGESGSNSRRVRILGEGSPDGDNDSDGGSGS------GSGDDQKKEKNGESGSNSRRVR 1312

Query: 385 DEGRGLPYRD*RKQDRVALSDTRGGRADFKGAEGCRVQNQEA*VKSRR 242
G G P D +D+ GG G + + +N E+ SRR
Sbjct: 1313 ILGEGSPDSD---------NDSDGGSGSGSGDDQKKEKNGESGSNSRR 1351



Score = 36.6 bits (83), Expect = 1.0
Identities = 31/108 (28%), Positives = 46/108 (42%)
Frame = -3

Query: 565 KNGESGANFREIRGASLGECEAEMQDSGGSNAV*QGWRASGCAIWKPRASCAQAKTREAR 386
KNGESG+N R +R G + + GGS + SG K + + + +R R
Sbjct: 1177 KNGESGSNSRRVRILGEGSPDGDNDSDGGSGS------GSGDDQKKEKNGESGSNSRRVR 1230

Query: 385 DEGRGLPYRD*RKQDRVALSDTRGGRADFKGAEGCRVQNQEA*VKSRR 242
G G P D +D+ GG G + + +N E+ SRR
Sbjct: 1231 ILGEGSPDGD---------NDSDGGSGSGSGDDQKKEKNGESGSNSRR 1269



Score = 34.3 bits (77), Expect = 5.0
Identities = 31/108 (28%), Positives = 47/108 (43%)
Frame = -3

Query: 565 KNGESGANFREIRGASLGECEAEMQDSGGSNAV*QGWRASGCAIWKPRASCAQAKTREAR 386
KNGESG+N R +R +L E + D+ + G SG K + + + +R R
Sbjct: 1132 KNGESGSNSRRVR--TLAEKDTPPDDTDYDSDGGSGGSGSGDDQKKEKNGESGSNSRRVR 1189

Query: 385 DEGRGLPYRD*RKQDRVALSDTRGGRADFKGAEGCRVQNQEA*VKSRR 242
G G P D +D+ GG G + + +N E+ SRR
Sbjct: 1190 ILGEGSPDGD---------NDSDGGSGSGSGDDQKKEKNGESGSNSRR 1228


>tr|Q4T6U1|Q4T6U1_TETNG Chromosome 21 SCAF8611, whole genome shotgun
sequence OS=Tetraodon nigroviridis GN=GSTENG00006125001
PE=4 SV=1
Length = 663

Score = 36.2 bits (82), Expect = 1.3
Identities = 22/54 (40%), Positives = 27/54 (50%)
Frame = -1

Query: 492 RTQEGATLSDRGGEPLGAPSGSREPAVRRPKLGRQEMKAVAYHTGTEGSRTE*H 331
R + GA L+ GGEP GA G+ EPA R GR+ A G G+R H
Sbjct: 447 RRRAGARLAGGGGEPAGA--GAAEPAARGAARGRRRAAAAGRDAGGGGARPGAH 498


>tr|B1ZCQ6|B1ZCQ6_METPB Amidohydrolase OS=Methylobacterium populi
(strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=Mpop_1247
PE=4 SV=1
Length = 464

Score = 33.9 bits (76), Expect = 6.6
Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 14/82 (17%)
Frame = +3

Query: 360 LYGRPRPSSLASLVLACAQLALGFQMAHPEALHPCQTALLPPESCIS------------- 500
LY RP +L S + A + L F A LPP+SC+
Sbjct: 126 LYIRPNDVTLDSTIAAAQGIGLRFHAARGAMSRGQSQGGLPPDSCVEREADILKDAERLI 185

Query: 501 -ASHSPRLAPLISLKLAPLSPF 563
A H P + + LAP SPF
Sbjct: 186 HAHHDPARHAMTRIVLAPCSPF 207


>tr|B7KWW0|B7KWW0_METCH Amidohydrolase OS=Methylobacterium
chloromethanicum CM4 GN=Mchl_2080 PE=4 SV=1
Length = 464

Score = 33.9 bits (76), Expect = 6.6
Identities = 24/82 (29%), Positives = 31/82 (37%), Gaps = 14/82 (17%)
Frame = +3

Query: 360 LYGRPRPSSLASLVLACAQLALGFQMAHPEALHPCQTALLPPESCIS------------- 500
LY RP +L S + A + L F A LPP+SC+
Sbjct: 126 LYIRPNDVTLDSTIAAARGIGLRFHAARGAMSRGQSQGGLPPDSCVEREADILKDAERLI 185

Query: 501 -ASHSPRLAPLISLKLAPLSPF 563
A H P + + LAP SPF
Sbjct: 186 HAHHDPARHAMTRIVLAPCSPF 207


>tr|A5G9E8|A5G9E8_GEOUR General secretory system II, protein E
domain protein OS=Geobacter uraniireducens (strain Rf4)
GN=Gura_4273 PE=4 SV=1
Length = 552

Score = 33.5 bits (75), Expect = 8.6
Identities = 14/35 (40%), Positives = 22/35 (62%)
Frame = -2

Query: 116 KGSSRFDHKGAINKKFAIILVPFGSPLCQAKESSR 12
KG DH G +K+ + L+PF SP+ +A E++R
Sbjct: 477 KGCQACDHTGYAGRKYLMGLIPFDSPMLEAFEAAR 511


>tr|Q14395|Q14395_HUMAN Mucin (Fragment) OS=Homo sapiens PE=2 SV=1
Length = 505

Score = 33.5 bits (75), Expect = 8.6
Identities = 20/82 (24%), Positives = 38/82 (46%)
Frame = +2

Query: 308 SSSSCIAQCYSVLLPSVPVW*ATAFISCLPSFGLRTAGSRLPDGAPRGSPPLSDSVAPS* 487
S+SS ++V+ P+ +A I P+ + +R+P G+ R PP++ ++ +
Sbjct: 339 STSSVTPSTHTVITPTHAQMSTSASIHSTPTGTVPPLTTRMPTGSTRTGPPMTGTIIQTS 398

Query: 488 VLHFGFTLPKASAPYLSEVGAT 553
H F+ K S S +T
Sbjct: 399 KAHNSFSTAKTSTSLHSHASST 420