BP919668
Clone id YMU001_000127_G05
Library
Length 529
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_G05.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
ATTAAAGATAGGAAATTAACACAGAAAGACAAACACATGGGATGGATAGCATCATAATGG
AGCTTAAAAGAACAGGAGTACTATGAAGGTAACAGACAAATATGGGTGCCAAAACCGCAG
GTTAGGGCATATGAAGTAACGTCAAGTCCGTCCCAGGACAGAAGGCCCACAAGCTATCAA
CCTCAACAATATCCTAGGATACCTAAGAAGCAGGTATACAATAGAACCACATTGAAAGAT
GTTAAAGTCAATCACAACTCTCAAGAGGATACAGAACAAAGACGGATCTCTCAAAGAATG
TTCCTCTTGGGGACAAGGATTCTACATAGGTTATACAAAGATTTGGCTACCAATCAACCA
AAAGCCAGCTGCAACTACACCAGACCTGCATGAAGATCTCAAGAACTCTACAAGACCTAG
AGCTCAACAAAGTCAACAAAATCAACAAAGGAGATATAAAGGTCATCAAGAGTTTGGATT
CCTAAGTCTTCCAATGCTCCTAGTCAAAAGCCAAATGCTGACAGCCAAC
■■Homology search results ■■ -
sp_hit_id Q03002
Definition sp|Q03002|YP141_YEAST Putative serine/threonine-protein kinase YPL141C OS=Saccharomyces cerevisiae
Align length 56
Score (bit) 35.0
E-value 0.22
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919668|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_G05.
(529 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q03002|YP141_YEAST Putative serine/threonine-protein kinase Y... 35 0.22
sp|Q57932|Y512_METJA Uncharacterized protein MJ0512 OS=Methanoca... 32 1.4
sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomy... 32 1.9
sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1 OS=C... 31 3.2
sp|Q54PD9|MED29_DICDI Putative mediator of RNA polymerase II tra... 31 3.2
sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4... 31 3.2
sp|Q09261|YQC2_CAEEL Uncharacterized protein C32A3.2 OS=Caenorha... 30 5.5
sp|Q5R7A3|TOIP1_PONAB Torsin-1A-interacting protein 1 OS=Pongo a... 30 5.5
sp|P37304|PAM1_YEAST Protein PAM1 OS=Saccharomyces cerevisiae GN... 30 5.5
sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit... 30 5.5
sp|P37963|SP6D_BACSU Stage VI sporulation protein D OS=Bacillus ... 30 7.2
sp|Q45715|CR1KA_BACTM Pesticidal crystal protein cry1Ka OS=Bacil... 30 7.2
sp|Q5JTV8|TOIP1_HUMAN Torsin-1A-interacting protein 1 OS=Homo sa... 30 9.4
sp|Q63627|SFR15_RAT Splicing factor, arginine/serine-rich 15 (Fr... 30 9.4
sp|Q9BVA0|KTNB1_HUMAN Katanin p80 WD40-containing subunit B1 OS=... 30 9.4
sp|Q9UPX6|K1024_HUMAN UPF0258 protein KIAA1024 OS=Homo sapiens G... 30 9.4

>sp|Q03002|YP141_YEAST Putative serine/threonine-protein kinase
YPL141C OS=Saccharomyces cerevisiae GN=YPL141C PE=1 SV=1
Length = 865

Score = 35.0 bits (79), Expect = 0.22
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = +1

Query: 130 YEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRISQR 297
Y +SS RPTSY P Y P YN TL ++N ++ + ++QR
Sbjct: 531 YRTSSSSHTKPRPTSYHPGSYTTPP----YNSNTLSIYEINEKAKSSASSQTLNQR 582


>sp|Q57932|Y512_METJA Uncharacterized protein MJ0512
OS=Methanocaldococcus jannaschii GN=MJ0512 PE=4 SV=1
Length = 237

Score = 32.3 bits (72), Expect = 1.4
Identities = 13/23 (56%), Positives = 18/23 (78%)
Frame = +1

Query: 181 PQQYPRIPKKQVYNRTTLKDVKV 249
P++ P IPK+Q+YNR + DVKV
Sbjct: 89 PREIPEIPKEQLYNRGEVLDVKV 111


>sp|Q06449|PIN3_YEAST [PSI+] inducibility protein 3 OS=Saccharomyces
cerevisiae GN=PIN3 PE=1 SV=1
Length = 215

Score = 32.0 bits (71), Expect = 1.9
Identities = 18/66 (27%), Positives = 30/66 (45%)
Frame = +1

Query: 109 PKPQVRAYEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRI 288
P PQ +A E+ P+Q+ +SYQ Q +P P Y + + + Q+ +Q+
Sbjct: 123 PPPQYKAQELQQIPTQNSAASSYQQQPFPP-PSTNYYQQPQQQPQQAPPPQQQQQQQQHQ 181

Query: 289 SQRMFL 306
S L
Sbjct: 182 SSHSHL 187


>sp|O01498|STAM1_CAEEL Signal transducing adapter molecule 1
OS=Caenorhabditis elegans GN=stam-1 PE=1 SV=2
Length = 457

Score = 31.2 bits (69), Expect = 3.2
Identities = 14/39 (35%), Positives = 20/39 (51%)
Frame = +1

Query: 79 YYEGNRQIWVPKPQVRAYEVTSSPSQDRRPTSYQPQQYP 195
Y + +Q +P RAY + P Q ++P Y PQ YP
Sbjct: 384 YQQPMQQYNYQQPPNRAYYPPTGPVQQQQPQQYPPQHYP 422


>sp|Q54PD9|MED29_DICDI Putative mediator of RNA polymerase II
transcription subunit 29 homolog OS=Dictyostelium
discoideum GN=med29 PE=3 SV=1
Length = 557

Score = 31.2 bits (69), Expect = 3.2
Identities = 23/115 (20%), Positives = 50/115 (43%), Gaps = 8/115 (6%)
Frame = +1

Query: 67 KEQEYYEGNRQIWVPKPQVRAYEVTSSPSQDRRPTSYQPQQYPRIPKK--------QVYN 222
++Q+ E Q P+ ++ ++ P Q P+ QPQQ P +P++
Sbjct: 335 QQQQPQEQIPQQQQPQLPMQQEQIQQLPQQQTPPSQQQPQQTPPLPQQFQQPLVNVNQIT 394

Query: 223 RTTLKDVKVNHNSQEDTEQRRISQRMFLLGTRILHRLYKDLATNQPKASCNYTRP 387
TL++ ++ N+ + + + IS + ++ + + L Q + + N T P
Sbjct: 395 SPTLENQSISGNNNNNNDGQTISPQQQQEQLQLQMQQLQQLQMQQQQMNFNPTEP 449


>sp|Q14839|CHD4_HUMAN Chromodomain-helicase-DNA-binding protein 4
OS=Homo sapiens GN=CHD4 PE=1 SV=1
Length = 1912

Score = 31.2 bits (69), Expect = 3.2
Identities = 19/59 (32%), Positives = 31/59 (52%), Gaps = 3/59 (5%)
Frame = +1

Query: 61 SLKEQEYYEGNRQIWVPKPQVRAYEVTSSP---SQDRRPTSYQPQQYPRIPKKQVYNRT 228
SLKE+E EG +++ P+ A E T +P S+D + P+ ++ K +V RT
Sbjct: 1570 SLKEEESIEGEKEVKSTAPET-AIECTQAPAPASEDEKVVVEPPEGEEKVEKAEVKERT 1627


>sp|Q09261|YQC2_CAEEL Uncharacterized protein C32A3.2
OS=Caenorhabditis elegans GN=C32A3.2 PE=2 SV=1
Length = 346

Score = 30.4 bits (67), Expect = 5.5
Identities = 15/48 (31%), Positives = 24/48 (50%), Gaps = 2/48 (4%)
Frame = +1

Query: 205 KKQVYNRTTLKDV--KVNHNSQEDTEQRRISQRMFLLGTRILHRLYKD 342
K Q + L DV KV E+TE+ Q++F + + ++YKD
Sbjct: 211 KLQEQRKALLNDVREKVEQEEVEETERSEKDQKLFTMALEFMEKIYKD 258


>sp|Q5R7A3|TOIP1_PONAB Torsin-1A-interacting protein 1 OS=Pongo
abelii GN=TOR1AIP1 PE=2 SV=1
Length = 598

Score = 30.4 bits (67), Expect = 5.5
Identities = 23/71 (32%), Positives = 34/71 (47%), Gaps = 2/71 (2%)
Frame = +1

Query: 64 LKEQEYYEGNRQIWVPKPQVRAYEVTSSPSQDRRPTSYQPQ--QYPRIPKKQVYNRTTLK 237
++E YY +RQ P+PQ + + RR T Q Q Q P + V R L+
Sbjct: 99 VRESAYYLRSRQRRQPRPQ------EAEEMKTRRTTRLQQQHSQQPPLQPSPVMTRRGLR 152

Query: 238 DVKVNHNSQED 270
D +H+S+ED
Sbjct: 153 D---SHSSEED 160


>sp|P37304|PAM1_YEAST Protein PAM1 OS=Saccharomyces cerevisiae
GN=PAM1 PE=1 SV=2
Length = 830

Score = 30.4 bits (67), Expect = 5.5
Identities = 28/109 (25%), Positives = 49/109 (44%), Gaps = 4/109 (3%)
Frame = +1

Query: 61 SLKEQEYYEGNRQIWVPKPQVRAYEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKD 240
SLKE+E + +++ E+ + +R Q QQY + P KQVY+ +
Sbjct: 487 SLKEREL----------EVRMKELELQERELELQRKALQQQQQYQQRPPKQVYSGPSGTP 536

Query: 241 VKVNHNSQEDTEQRRIS----QRMFLLGTRILHRLYKDLATNQPKASCN 375
N+N++ R+ S Q + ++ +R LH A++ P S N
Sbjct: 537 TSGNNNNKSYNPNRKSSYSQPQHVAMMTSRGLHG--PSAASSSPVISAN 583


>sp|Q8H0T9|KTNB1_ARATH Katanin p80 WD40 repeat-containing subunit B1
homolog 1 OS=Arabidopsis thaliana GN=At5g23430 PE=2 SV=3
Length = 837

Score = 30.4 bits (67), Expect = 5.5
Identities = 24/67 (35%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
Frame = +2

Query: 125 GHMK*RQVRPRTEGPQAINLNN---ILGYLRSRYTIEPH*KMLKSITTLKRIQNKDGSLK 295
GH + R R P +N NN +LG L ++P K KS+ L QN D S K
Sbjct: 314 GHPEKRSCSGRD--PVVLNDNNSKTVLGKLSVSQNVDPLLKETKSLGRLSVSQNSDPSTK 371

Query: 296 ECSSWGQ 316
E S G+
Sbjct: 372 ETKSIGR 378


tr_hit_id B5VT25
Definition tr|B5VT25|B5VT25_YEAS6 YPL141Cp-like protein (Fragment) OS=Saccharomyces cerevisiae (strain AWRI1631)
Align length 56
Score (bit) 35.0
E-value 2.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919668|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_G05.
(529 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5VT25|B5VT25_YEAS6 YPL141Cp-like protein (Fragment) OS=Sacch... 35 2.4
tr|B3LKT5|B3LKT5_YEAS1 Putative uncharacterized protein OS=Sacch... 35 2.4
tr|A6ZWB2|A6ZWB2_YEAS7 Conserved protein OS=Saccharomyces cerevi... 35 2.4
tr|B8LD79|B8LD79_THAPS Predicted protein OS=Thalassiosira pseudo... 35 3.1
tr|B3MEX8|B3MEX8_DROAN GF11866 OS=Drosophila ananassae GN=GF1186... 33 6.9
tr|Q2H3D5|Q2H3D5_CHAGB Putative uncharacterized protein OS=Chaet... 33 6.9
tr|B7ATZ2|B7ATZ2_9BACE Putative uncharacterized protein OS=Bacte... 33 9.0
tr|Q24E21|Q24E21_TETTH Putative uncharacterized protein OS=Tetra... 33 9.0
tr|A0BRD4|A0BRD4_PARTE Chromosome undetermined scaffold_122, who... 33 9.0
tr|B6Q2I5|B6Q2I5_PENMA Putative uncharacterized protein OS=Penic... 33 9.0

>tr|B5VT25|B5VT25_YEAS6 YPL141Cp-like protein (Fragment)
OS=Saccharomyces cerevisiae (strain AWRI1631)
GN=AWRI1631_161240 PE=4 SV=1
Length = 693

Score = 35.0 bits (79), Expect = 2.4
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = +1

Query: 130 YEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRISQR 297
Y +SS RPTSY P Y P YN TL ++N ++ + ++QR
Sbjct: 531 YRTSSSSHTKPRPTSYHPGSYTTPP----YNSNTLSIYEINEKAKSSASSQTLNQR 582


>tr|B3LKT5|B3LKT5_YEAS1 Putative uncharacterized protein
OS=Saccharomyces cerevisiae (strain RM11-1a)
GN=SCRG_02355 PE=4 SV=1
Length = 865

Score = 35.0 bits (79), Expect = 2.4
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = +1

Query: 130 YEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRISQR 297
Y +SS RPTSY P Y P YN TL ++N ++ + ++QR
Sbjct: 531 YRTSSSSHTKPRPTSYHPGSYTTPP----YNSNTLSIYEINEKAKSSASSQTLNQR 582


>tr|A6ZWB2|A6ZWB2_YEAS7 Conserved protein OS=Saccharomyces
cerevisiae (strain YJM789) GN=SCY_5589 PE=4 SV=1
Length = 865

Score = 35.0 bits (79), Expect = 2.4
Identities = 18/56 (32%), Positives = 26/56 (46%)
Frame = +1

Query: 130 YEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRISQR 297
Y +SS RPTSY P Y P YN TL ++N ++ + ++QR
Sbjct: 531 YRTSSSSHTKPRPTSYHPGSYTTPP----YNSNTLSIYEINEKAKSSASSQTLNQR 582


>tr|B8LD79|B8LD79_THAPS Predicted protein OS=Thalassiosira
pseudonana CCMP1335 GN=THAPSDRAFT_11155 PE=4 SV=1
Length = 447

Score = 34.7 bits (78), Expect = 3.1
Identities = 24/93 (25%), Positives = 40/93 (43%), Gaps = 8/93 (8%)
Frame = +1

Query: 109 PKPQVRAYEVTSSPSQDRRPTSYQPQQYPRIPK--------KQVYNRTTLKDVKVNHNSQ 264
P P + T++P+ +S+Q Q P P +QV N+ ++NHN
Sbjct: 170 PLPVIEGMPTTNAPTNASTLSSFQQDQSPAFPPSFVNPYAIQQVRNQKQNVQQQMNHNPT 229

Query: 265 EDTEQRRISQRMFLLGTRILHRLYKDLATNQPK 363
E T + +++ F T + Y D A QP+
Sbjct: 230 ESTSKSKVNANAFQPFTSQAAQFY-DTAIPQPQ 261


>tr|B3MEX8|B3MEX8_DROAN GF11866 OS=Drosophila ananassae GN=GF11866
PE=4 SV=1
Length = 1106

Score = 33.5 bits (75), Expect = 6.9
Identities = 18/64 (28%), Positives = 29/64 (45%), Gaps = 1/64 (1%)
Frame = +1

Query: 109 PKPQVRAYEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLK-DVKVNHNSQEDTEQRR 285
PKPQV+ P Q ++ S QQ P + ++N+ + +NHN Q Q+
Sbjct: 345 PKPQVQQQVSQLQPQQQQQRPSITQQQLPSTSSQTIFNKLVQQSQYYINHNQQYQQHQQS 404

Query: 286 ISQR 297
Q+
Sbjct: 405 HQQQ 408


>tr|Q2H3D5|Q2H3D5_CHAGB Putative uncharacterized protein
OS=Chaetomium globosum GN=CHGG_03711 PE=4 SV=1
Length = 878

Score = 33.5 bits (75), Expect = 6.9
Identities = 18/63 (28%), Positives = 31/63 (49%)
Frame = +1

Query: 109 PKPQVRAYEVTSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRI 288
P P E ++P Q+ RP YQPQQ + Q + + + +H++Q D Q ++
Sbjct: 806 PPPPSHHQEYNTAPQQEYRPQQYQPQQEYQPSHYQPRPQQHPQQHQADHHAQPDDYQPQL 865

Query: 289 SQR 297
Q+
Sbjct: 866 YQQ 868


>tr|B7ATZ2|B7ATZ2_9BACE Putative uncharacterized protein
OS=Bacteroides pectinophilus ATCC 43243 GN=BACPEC_01614
PE=4 SV=1
Length = 76

Score = 33.1 bits (74), Expect = 9.0
Identities = 14/38 (36%), Positives = 25/38 (65%)
Frame = +2

Query: 215 YTIEPH*KMLKSITTLKRIQNKDGSLKECSSWGQGFYI 328
YTIEP M + TT +R+++++G +KE +G+Y+
Sbjct: 33 YTIEPAVAMSANYTTTERLKSREGVVKEVGENPRGYYV 70


>tr|Q24E21|Q24E21_TETTH Putative uncharacterized protein
OS=Tetrahymena thermophila SB210 GN=TTHERM_00853190 PE=4
SV=2
Length = 2578

Score = 33.1 bits (74), Expect = 9.0
Identities = 18/53 (33%), Positives = 29/53 (54%)
Frame = +1

Query: 139 TSSPSQDRRPTSYQPQQYPRIPKKQVYNRTTLKDVKVNHNSQEDTEQRRISQR 297
TSSPSQD TS Q ++ +K YN +D KV SQ + ++++++
Sbjct: 1917 TSSPSQDTSITSLQLDISTKLGQKMNYNSLPNEDAKVFTGSQISIQSQQVTEK 1969


>tr|A0BRD4|A0BRD4_PARTE Chromosome undetermined scaffold_122, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00031332001 PE=4 SV=1
Length = 626

Score = 33.1 bits (74), Expect = 9.0
Identities = 16/46 (34%), Positives = 26/46 (56%), Gaps = 3/46 (6%)
Frame = +1

Query: 136 VTSSPSQDRRPTS---YQPQQYPRIPKKQVYNRTTLKDVKVNHNSQ 264
+T+S +D++ S Y PQQY + K V+N L ++ +NSQ
Sbjct: 580 ITASQIEDQQNYSKNLYSPQQYQNVDKSNVFNNNRLSVTRILNNSQ 625


>tr|B6Q2I5|B6Q2I5_PENMA Putative uncharacterized protein
OS=Penicillium marneffei ATCC 18224 GN=PMAA_018500 PE=4
SV=1
Length = 774

Score = 33.1 bits (74), Expect = 9.0
Identities = 21/101 (20%), Positives = 52/101 (51%), Gaps = 7/101 (6%)
Frame = +1

Query: 76 EYYEGNRQIWVPKPQVRAYEVTSSPSQD----RRPTSYQPQQYPRIPKKQVYNRTTLKDV 243
++ + N Q + +PQ++ + +SP ++ R+ +Q +Q+ +KQ+ + +
Sbjct: 43 QFTQANHQQYHAQPQIQPQQQANSPLRNQVNHRQVYGHQMEQFLNEQRKQIQQQMEQRMA 102

Query: 244 KVNHNSQEDTEQRRISQRMFLLGT---RILHRLYKDLATNQ 357
Q++T++ +SQ LG ++ + +KD+A++Q
Sbjct: 103 VQRKIDQQNTDKFEVSQVQARLGNEACKVQNFPFKDMASDQ 143