BP919682
Clone id YMU001_000127_H07
Library
Length 528
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000127_H07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
ATGTGGGGAAATGGGCTTTTGAACAAGCTGTAAAAGTGGATAGAAGTGATGAGACATCTT
ACATTCTCCTTGGGAATATTTATGCCGCAGCGGGCATGAAAGATAAGGCAAAAGATATTG
AAGCCTTGAGAATTAGGGCCAAGGCATGAAAGGCTACAAAGGGTAATGTGCTTTGTTATC
TGTTGGAGAAGTTGGCCCTTGCATGTCCAGTGATTAGCACACCTCTCAGACAAATGAGGA
TTGTTATGTTGGTGCATGACAAACAATTGTGGCCTTGATTACACCAGTTTTTGTCATTGA
TTTGGAGATGGAAAGTGTTTTGTAGCGATCACGAAAGATTAGGTGGCTCCCTTGTGCATA
ATCAATCACTTTCAGGGGACATTGTGATTGCCATTCAATGCTTCGCTTATATCTAATTTA
AATACTCCCGCAATTGTGATCATGAATACCAATTTCTGTCATCACTTTTGAAGTATGAAG
GTGAAGAGCAATCTCTGTCATCACTTTTGAAGTATGAAGGTGAAGAGC
■■Homology search results ■■ -
sp_hit_id Q9C9I6
Definition sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protein At1g71490 OS=Arabidopsis thaliana
Align length 42
Score (bit) 36.2
E-value 0.099
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919682|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_H07.
(528 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protei... 36 0.099
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 34 0.38
sp|Q9SCT2|PP277_ARATH Pentatricopeptide repeat-containing protei... 34 0.38
sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protei... 34 0.38
sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protei... 34 0.49
sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containi... 34 0.49
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protei... 33 1.1
sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protei... 32 1.9
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 32 1.9
sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containi... 31 3.2
sp|Q8H6G9|PHT17_ORYSJ Probable inorganic phosphate transporter 1... 31 3.2
sp|O80488|PPR23_ARATH Pentatricopeptide repeat-containing protei... 31 4.1
sp|Q5G1T1|PP272_ARATH Pentatricopeptide repeat-containing protei... 31 4.1
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 31 4.1
sp|O64766|PP185_ARATH Pentatricopeptide repeat-containing protei... 31 4.1
sp|Q9CA56|PP121_ARATH Pentatricopeptide repeat-containing protei... 31 4.1
sp|O34374|YJIB_BACSU Putative cytochrome P450 yjiB OS=Bacillus s... 30 5.4
sp|Q9M2Y4|PP276_ARATH Pentatricopeptide repeat-containing protei... 30 5.4
sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protei... 30 5.4
sp|Q9LRV9|PP228_ARATH Pentatricopeptide repeat-containing protei... 30 5.4
sp|Q9SIL5|PP165_ARATH Pentatricopeptide repeat-containing protei... 30 5.4
sp|Q9FG16|PP367_ARATH Pentatricopeptide repeat-containing protei... 30 7.1
sp|Q9S7F4|PP206_ARATH Putative pentatricopeptide repeat-containi... 30 7.1
sp|Q3ECB8|PP128_ARATH Pentatricopeptide repeat-containing protei... 30 7.1
sp|Q16CP0|DXS2_ROSDO 1-deoxy-D-xylulose-5-phosphate synthase 2 O... 30 7.1
sp|Q4LDE5|SVEP1_HUMAN Sushi, von Willebrand factor type A, EGF a... 30 9.2
sp|Q9FHF9|PP419_ARATH Pentatricopeptide repeat-containing protei... 30 9.2
sp|Q9SMZ2|PP347_ARATH Pentatricopeptide repeat-containing protei... 30 9.2
sp|Q9SKQ4|PP167_ARATH Pentatricopeptide repeat-containing protei... 30 9.2
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 30 9.2

>sp|Q9C9I6|PP116_ARATH Pentatricopeptide repeat-containing protein
At1g71490 OS=Arabidopsis thaliana GN=PCMP-E67 PE=2 SV=1
Length = 681

Score = 36.2 bits (82), Expect = 0.099
Identities = 14/42 (33%), Positives = 26/42 (61%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEAL 128
+GKWA E+ +++ + Y+L+ N+YAAAG K ++ +
Sbjct: 569 IGKWAAEKLLEMKPENPGYYVLIANMYAAAGSWSKLAEVRTI 610


>sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protein
At3g57430, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H81 PE=2 SV=2
Length = 890

Score = 34.3 bits (77), Expect = 0.38
Identities = 13/39 (33%), Positives = 28/39 (71%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDI 119
+G+ A + ++++ + + Y+LL NIY++AG+ DKA ++
Sbjct: 705 IGEIAAQNLIQLEPNVASHYVLLANIYSSAGLWDKATEV 743


>sp|Q9SCT2|PP277_ARATH Pentatricopeptide repeat-containing protein
At3g50420 OS=Arabidopsis thaliana GN=PCMP-E85 PE=2 SV=1
Length = 794

Score = 34.3 bits (77), Expect = 0.38
Identities = 18/60 (30%), Positives = 35/60 (58%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEALRIRAKA*KATKGNVLCYL 182
+G +A EQ +K+D D ++ILL N+YA G + +D+ +R + + ++K L ++
Sbjct: 690 IGLYAAEQILKLDPEDTATHILLSNLYAVNG---RWEDVAEMRRKIRGLASSKDPGLSWI 746


>sp|Q9LTV8|PP224_ARATH Pentatricopeptide repeat-containing protein
At3g12770 OS=Arabidopsis thaliana GN=PCMP-H43 PE=2 SV=1
Length = 694

Score = 34.3 bits (77), Expect = 0.38
Identities = 20/62 (32%), Positives = 35/62 (56%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEALRIRAKA*KATKGNVLCYL 182
+G++A +Q +D S+ Y+ L N+YAAA + D+ ++ R+R K K +V C
Sbjct: 509 LGEYAAQQLFSIDPSNTGHYVQLSNLYAAARLWDRVAEV---RVRMKE-KGLNKDVGCSW 564

Query: 183 LE 188
+E
Sbjct: 565 VE 566


>sp|Q9FWA6|PP207_ARATH Pentatricopeptide repeat-containing protein
At3g02330 OS=Arabidopsis thaliana GN=PCMP-E90 PE=2 SV=2
Length = 903

Score = 33.9 bits (76), Expect = 0.49
Identities = 15/39 (38%), Positives = 24/39 (61%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDI 119
V + A +++D D ++Y LL N+YA AGM +K D+
Sbjct: 791 VAEEATAALLRLDPQDSSAYTLLSNVYADAGMWEKVSDL 829


>sp|Q9CAA8|PP108_ARATH Putative pentatricopeptide repeat-containing
protein At1g68930 OS=Arabidopsis thaliana GN=PCMP-H22
PE=3 SV=1
Length = 743

Score = 33.9 bits (76), Expect = 0.49
Identities = 14/39 (35%), Positives = 21/39 (53%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDI 119
+GKWA E +++D Y LL +IYA+ G D +
Sbjct: 558 IGKWAAESLIELDPHHPAGYTLLSSIYASKGKWDSVAQL 596


>sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protein
At5g15300 OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=2
Length = 548

Score = 32.7 bits (73), Expect = 1.1
Identities = 13/42 (30%), Positives = 25/42 (59%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEAL 128
+GK+A E+ + + + + Y+LL NIYA+ G D + + +
Sbjct: 466 LGKYANEKLLSMRKDESGDYVLLSNIYASTGQWDGVQKVRKM 507


>sp|Q9LN01|PPR21_ARATH Pentatricopeptide repeat-containing protein
At1g08070 OS=Arabidopsis thaliana GN=PCMP-H12 PE=2 SV=1
Length = 741

Score = 32.0 bits (71), Expect = 1.9
Identities = 15/42 (35%), Positives = 25/42 (59%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEAL 128
+G+ E +K++ + SY+LL NIYA+AG ++ AL
Sbjct: 556 LGESFAENLIKIEPENPGSYVLLSNIYASAGRWNEVAKTRAL 597


>sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protein
At4g13650 OS=Arabidopsis thaliana GN=PCMP-H42 PE=2 SV=2
Length = 1064

Score = 32.0 bits (71), Expect = 1.9
Identities = 15/54 (27%), Positives = 31/54 (57%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEALRIRAKA*KATKG 164
+G++A ++++ D +Y+LL N+YA + D A+D+ +++ K K G
Sbjct: 879 IGEFAAHHLLELEPEDSATYVLLSNLYAVSKKWD-ARDLTRQKMKEKGVKKEPG 931


>sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containing
protein At5g09950 OS=Arabidopsis thaliana GN=PCMP-H35
PE=3 SV=1
Length = 995

Score = 31.2 bits (69), Expect = 3.2
Identities = 13/31 (41%), Positives = 21/31 (67%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAG 95
+GK A E +++ + +Y+LLGN+YAA G
Sbjct: 809 LGKKAAEMLFQLEPENAVNYVLLGNMYAAGG 839


tr_hit_id A7NVQ5
Definition tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome shotgun sequence OS=Vitis vinifera
Align length 42
Score (bit) 39.7
E-value 0.094
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919682|Adiantum capillus-veneris mRNA, clone:
YMU001_000127_H07.
(528 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome... 40 0.094
tr|Q8S693|Q8S693_ORYSJ Putative uncharacterized protein OJ1004_D... 39 0.12
tr|Q10IY6|Q10IY6_ORYSJ Os03g0441400 protein OS=Oryza sativa subs... 39 0.12
tr|A2XIE6|A2XIE6_ORYSI Putative uncharacterized protein OS=Oryza... 39 0.12
tr|A7PL13|A7PL13_VITVI Chromosome chr7 scaffold_20, whole genome... 39 0.21
tr|A5AZY0|A5AZY0_VITVI Putative uncharacterized protein OS=Vitis... 39 0.21
tr|B3U1P3|B3U1P3_9MARC Pentatricopeptide repeat protein (Fragmen... 38 0.27
tr|A5AJY4|A5AJY4_VITVI Putative uncharacterized protein OS=Vitis... 38 0.36
tr|Q1KUT6|Q1KUT6_9ROSI Putative uncharacterized protein OS=Cleom... 37 0.47
tr|Q94I34|Q94I34_ORYSJ Putative selenium-binding protein-like (P... 37 0.61
tr|A7P600|A7P600_VITVI Chromosome chr4 scaffold_6, whole genome ... 36 1.0
tr|A7PNA8|A7PNA8_VITVI Chromosome chr1 scaffold_22, whole genome... 36 1.4
tr|B3U1P2|B3U1P2_9MARC Pentatricopeptide repeat protein (Fragmen... 35 1.8
tr|A7QFC9|A7QFC9_VITVI Chromosome undetermined scaffold_87, whol... 35 1.8
tr|A5AYH4|A5AYH4_VITVI Putative uncharacterized protein OS=Vitis... 35 1.8
tr|A7PA64|A7PA64_VITVI Chromosome chr14 scaffold_9, whole genome... 35 2.3
tr|Q6ZLQ1|Q6ZLQ1_ORYSJ Os07g0150000 protein OS=Oryza sativa subs... 35 3.0
tr|Q6Z0F9|Q6Z0F9_ORYSJ Os08g0340900 protein OS=Oryza sativa subs... 35 3.0
tr|Q6H4W1|Q6H4W1_ORYSJ Putative pentatricopeptide (PPR) repeat-c... 35 3.0
tr|Q60EM0|Q60EM0_ORYSJ Os05g0455900 protein OS=Oryza sativa subs... 35 3.0
tr|Q0E3L9|Q0E3L9_ORYSJ Os02g0167200 protein (Fragment) OS=Oryza ... 35 3.0
tr|B8B9V6|B8B9V6_ORYSI Putative uncharacterized protein OS=Oryza... 35 3.0
tr|B8B7B5|B8B7B5_ORYSI Putative uncharacterized protein OS=Oryza... 35 3.0
tr|B8AIK6|B8AIK6_ORYSI Putative uncharacterized protein OS=Oryza... 35 3.0
tr|A7PUI0|A7PUI0_VITVI Chromosome chr7 scaffold_31, whole genome... 35 3.0
tr|A3BS46|A3BS46_ORYSJ Putative uncharacterized protein OS=Oryza... 35 3.0
tr|A3BGL5|A3BGL5_ORYSJ Putative uncharacterized protein OS=Oryza... 35 3.0
tr|A3A3I4|A3A3I4_ORYSJ Putative uncharacterized protein OS=Oryza... 35 3.0
tr|A2Y5C6|A2Y5C6_ORYSI Putative uncharacterized protein OS=Oryza... 35 3.0
tr|B3U1N4|B3U1N4_9MARC Pentatricopeptide repeat protein (Fragmen... 34 4.0

>tr|A7NVQ5|A7NVQ5_VITVI Chromosome chr18 scaffold_1, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015527001
PE=4 SV=1
Length = 637

Score = 39.7 bits (91), Expect = 0.094
Identities = 19/42 (45%), Positives = 27/42 (64%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEAL 128
+GK EQ + +D SD +YI+L NIY+AAG+ A + AL
Sbjct: 452 LGKEVAEQLLSLDPSDHRNYIMLSNIYSAAGLWRDASKVRAL 493


>tr|Q8S693|Q8S693_ORYSJ Putative uncharacterized protein
OJ1004_D04.31 OS=Oryza sativa subsp. japonica
GN=OJ1004_D04.31 PE=4 SV=1
Length = 1012

Score = 39.3 bits (90), Expect = 0.12
Identities = 15/35 (42%), Positives = 28/35 (80%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDK 107
+G+++ E+ ++++ DET+Y+LL N+YAAAG D+
Sbjct: 652 LGRFSAEKILEIEPQDETTYVLLSNMYAAAGSLDQ 686


>tr|Q10IY6|Q10IY6_ORYSJ Os03g0441400 protein OS=Oryza sativa subsp.
japonica GN=Os03g0441400 PE=2 SV=1
Length = 837

Score = 39.3 bits (90), Expect = 0.12
Identities = 15/35 (42%), Positives = 28/35 (80%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDK 107
+G+++ E+ ++++ DET+Y+LL N+YAAAG D+
Sbjct: 652 LGRFSAEKILEIEPQDETTYVLLSNMYAAAGSLDQ 686


>tr|A2XIE6|A2XIE6_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12205 PE=4 SV=1
Length = 818

Score = 39.3 bits (90), Expect = 0.12
Identities = 15/35 (42%), Positives = 28/35 (80%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDK 107
+G+++ E+ ++++ DET+Y+LL N+YAAAG D+
Sbjct: 633 LGRFSAEKILEIEPQDETTYVLLSNMYAAAGSLDQ 667


>tr|A7PL13|A7PL13_VITVI Chromosome chr7 scaffold_20, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00019394001
PE=4 SV=1
Length = 812

Score = 38.5 bits (88), Expect = 0.21
Identities = 18/39 (46%), Positives = 24/39 (61%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDI 119
+GK+A E A+ D D SYILL NI+A+ GM K +
Sbjct: 706 LGKYAAEMAISTDPKDSGSYILLSNIFASKGMWADVKKV 744


>tr|A5AZY0|A5AZY0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_038220 PE=4 SV=1
Length = 732

Score = 38.5 bits (88), Expect = 0.21
Identities = 18/39 (46%), Positives = 24/39 (61%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDI 119
+GK+A E A+ D D SYILL NI+A+ GM K +
Sbjct: 627 LGKYAAEMAISTDPKDSGSYILLSNIFASKGMWADVKKV 665


>tr|B3U1P3|B3U1P3_9MARC Pentatricopeptide repeat protein (Fragment)
OS=Lepidogyna hodgsoniae GN=PPR PE=4 SV=1
Length = 143

Score = 38.1 bits (87), Expect = 0.27
Identities = 16/44 (36%), Positives = 30/44 (68%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEALRI 134
+G+ + +++D + + Y++L NIYAAAG D++ DI+ LR+
Sbjct: 4 MGERIARKVLELDPQNASGYVMLSNIYAAAGKWDRSADIQQLRM 47


>tr|A5AJY4|A5AJY4_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031840 PE=4 SV=1
Length = 714

Score = 37.7 bits (86), Expect = 0.36
Identities = 18/42 (42%), Positives = 26/42 (61%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEAL 128
+GK EQ + +D SD +YI+L NIY+AAG+ A + L
Sbjct: 529 LGKEVAEQLLSLDPSDHRNYIMLSNIYSAAGLWRXASKVRXL 570


>tr|Q1KUT6|Q1KUT6_9ROSI Putative uncharacterized protein OS=Cleome
spinosa PE=4 SV=1
Length = 924

Score = 37.4 bits (85), Expect = 0.47
Identities = 16/30 (53%), Positives = 23/30 (76%)
Frame = +3

Query: 30 VKVDRSDETSYILLGNIYAAAGMKDKAKDI 119
+++D D ++YILL NIYA AGM DKA ++
Sbjct: 808 LRLDPQDSSTYILLSNIYADAGMWDKASEL 837


>tr|Q94I34|Q94I34_ORYSJ Putative selenium-binding protein-like
(Putative uncharacterized protein) (Pentatricopeptide,
putative) OS=Oryza sativa subsp. japonica
GN=OSJNBa0050N08.17 PE=4 SV=1
Length = 651

Score = 37.0 bits (84), Expect = 0.61
Identities = 17/42 (40%), Positives = 27/42 (64%)
Frame = +3

Query: 3 VGKWAFEQAVKVDRSDETSYILLGNIYAAAGMKDKAKDIEAL 128
+G+ A + V++D SD Y+LL N+YA A M+ KA + A+
Sbjct: 547 LGEKAAMKLVEIDPSDSGIYVLLANMYAEANMRKKADKVRAM 588