BP919690
Clone id YMU001_000128_A07
Library
Length 414
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000128_A07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CCTAAATATCCAATTTCAATTGGATTGCAGCCAAGCCTACATCCATGCCCAAAGCGTGCT
TATCAACAACCTCCAAGAAAGCTTTGATTCATACCACAACCTTATAGAAGAAAGGCTCCT
AGACCTCACGAAGAAGATTGCTACCGTTTCCTTTCCTAGAGTCCAACCTTCGGCTTGGGC
CAATCAACTCCTCTCTTGGAAGCTTTCCTCGCTTCACGAGTTTGATGCTCTACTTCAAAA
TGCTATCCTCCAAACCCATTTGGCTTCCTCTTTGAACTCGGCAGCACATAATGCTAGAAA
GAGGGCGCAAGCTACCATTTTGGAGGAAGCGGAGTCTCTACCCAAAGAGAAAACAGTGGG
AGAATTGGTGCATCATGAAGTCACCACTCAAATGAAGAACCTTCTTTCACCTCC
■■Homology search results ■■ -
sp_hit_id Q98SV1
Definition sp|Q98SV1|SELPA_DANRE Selenoprotein Pa OS=Danio rerio
Align length 50
Score (bit) 34.3
E-value 0.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919690|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_A07.
(414 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q98SV1|SELPA_DANRE Selenoprotein Pa OS=Danio rerio GN=sepp1a ... 34 0.20
sp|O43365|HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens GN=... 30 4.9
sp|P13983|EXTN_TOBAC Extensin OS=Nicotiana tabacum GN=HRGPNT3 PE... 30 4.9

>sp|Q98SV1|SELPA_DANRE Selenoprotein Pa OS=Danio rerio GN=sepp1a
PE=1 SV=3
Length = 367

Score = 34.3 bits (77), Expect = 0.20
Identities = 17/50 (34%), Positives = 29/50 (58%)
Frame = +2

Query: 29 SQAYIHAQSVLINNLQESFDSYHNLIEERLLDLTKKIATVSFPRVQPSAW 178
+Q Y + +++NN +E H+L++ERLL++T +S QP AW
Sbjct: 78 NQGYPNIAYMVVNNREERSQRLHHLLQERLLNITLYAQDLS----QPDAW 123


>sp|O43365|HXA3_HUMAN Homeobox protein Hox-A3 OS=Homo sapiens
GN=HOXA3 PE=2 SV=1
Length = 443

Score = 29.6 bits (65), Expect = 4.9
Identities = 23/71 (32%), Positives = 31/71 (43%), Gaps = 3/71 (4%)
Frame = +1

Query: 1 PKYPISIGLQPSLHPCPKRA---YQQPPRKL*FIPQPYRRKAPRPHEEDCYRFLS*SPTF 171
P P S+G +P LHP P +A QPP+ P P P P + S +PT
Sbjct: 79 PSQPPSLG-EPPLHPPPPQAAPPAPQPPQPAPQPPAPTPAAPPPPSSASPPQNASNNPTP 137

Query: 172 GLGQSTPLLEA 204
+PLL +
Sbjct: 138 ANAAKSPLLNS 148


>sp|P13983|EXTN_TOBAC Extensin OS=Nicotiana tabacum GN=HRGPNT3 PE=2
SV=1
Length = 620

Score = 29.6 bits (65), Expect = 4.9
Identities = 20/64 (31%), Positives = 27/64 (42%)
Frame = +1

Query: 1 PKYPISIGLQPSLHPCPKRAYQQPPRKL*FIPQPYRRKAPRPHEEDCYRFLS*SPTFGLG 180
P PI P + P P PPR++ P P+R+ PRP +PT+G
Sbjct: 483 PPSPIYSPPPPQVQPLPPTFSPPPPRRIHLPPPPHRQ--PRPP----------TPTYGQP 530

Query: 181 QSTP 192
S P
Sbjct: 531 PSPP 534


tr_hit_id B3MA95
Definition tr|B3MA95|B3MA95_DROAN GF25139 OS=Drosophila ananassae
Align length 86
Score (bit) 35.0
E-value 1.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919690|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_A07.
(414 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3MA95|B3MA95_DROAN GF25139 OS=Drosophila ananassae GN=GF2513... 35 1.9
tr|Q2NR73|Q2NR73_SODGM Type III secretion apparatus OS=Sodalis g... 35 2.4
tr|Q6R8A4|Q6R8A4_SODGL PrgJ OS=Sodalis glossinidius GN=prgJ PE=4... 35 2.4
tr|Q6P3K0|Q6P3K0_DANRE Sepp1a protein OS=Danio rerio GN=sepp1a P... 34 3.2
tr|A9JRW5|A9JRW5_DANRE Selenoprotein P, plasma, 1a OS=Danio reri... 34 3.2
tr|Q97HF6|Q97HF6_CLOAB Predicted transcriptional regulator OS=Cl... 33 9.3

>tr|B3MA95|B3MA95_DROAN GF25139 OS=Drosophila ananassae GN=GF25139
PE=4 SV=1
Length = 2342

Score = 35.0 bits (79), Expect = 1.9
Identities = 27/86 (31%), Positives = 35/86 (40%)
Frame = +1

Query: 1 PKYPISIGLQPSLHPCPKRAYQQPPRKL*FIPQPYRRKAPRPHEEDCYRFLS*SPTFGLG 180
P P+ QP +P P AYQ P F+ Y R +P P F S SP L
Sbjct: 965 PASPLKYQQQPITYPAPIEAYQCPKINPNFLTPKYER-SPLPRSSSSSNFPSPSPVKFLS 1023

Query: 181 QSTPLLEAFLASRV*CSTSKCYPPNP 258
++ + AS + S PPNP
Sbjct: 1024 TTSGTVTVTPAS---LTKSPLAPPNP 1046


>tr|Q2NR73|Q2NR73_SODGM Type III secretion apparatus OS=Sodalis
glossinidius (strain morsitans) GN=SG2077 PE=4 SV=1
Length = 103

Score = 34.7 bits (78), Expect = 2.4
Identities = 28/93 (30%), Positives = 42/93 (45%)
Frame = -3

Query: 304 PLSSIMCCRVQRGSQMGLEDSILK*SIKLVKRGKLPREELIGPSRRLDSRKGNGSNLLRE 125
PLS + Q+G L++ I+ V +G R EL+ P L R G SN+L++
Sbjct: 13 PLSHLPALSAQQGGMQSLDEKIMHALADGVAQGHHARAELLRPPSSLSLRPGGLSNMLQQ 72

Query: 124 V*EPFFYKVVV*IKAFLEVVDKHALGMDVGLAA 26
+ Y V + A L V+K L + L A
Sbjct: 73 QIKGMKYAVSTSLTATL--VNKLTLAVKTVLGA 103


>tr|Q6R8A4|Q6R8A4_SODGL PrgJ OS=Sodalis glossinidius GN=prgJ PE=4
SV=1
Length = 103

Score = 34.7 bits (78), Expect = 2.4
Identities = 28/93 (30%), Positives = 42/93 (45%)
Frame = -3

Query: 304 PLSSIMCCRVQRGSQMGLEDSILK*SIKLVKRGKLPREELIGPSRRLDSRKGNGSNLLRE 125
PLS + Q+G L++ I+ V +G R EL+ P L R G SN+L++
Sbjct: 13 PLSHLPALSAQQGGMQSLDEKIMHALADGVAQGHHARAELLRPPSSLSLRPGGLSNMLQQ 72

Query: 124 V*EPFFYKVVV*IKAFLEVVDKHALGMDVGLAA 26
+ Y V + A L V+K L + L A
Sbjct: 73 QIKGMKYAVSTSLTATL--VNKLTLAVKTVLGA 103


>tr|Q6P3K0|Q6P3K0_DANRE Sepp1a protein OS=Danio rerio GN=sepp1a PE=2
SV=2
Length = 367

Score = 34.3 bits (77), Expect = 3.2
Identities = 17/50 (34%), Positives = 29/50 (58%)
Frame = +2

Query: 29 SQAYIHAQSVLINNLQESFDSYHNLIEERLLDLTKKIATVSFPRVQPSAW 178
+Q Y + +++NN +E H+L++ERLL++T +S QP AW
Sbjct: 78 NQGYPNIAYMVVNNREERSQRLHHLLQERLLNITLYAQDLS----QPDAW 123


>tr|A9JRW5|A9JRW5_DANRE Selenoprotein P, plasma, 1a OS=Danio rerio
GN=sepp1a PE=2 SV=2
Length = 367

Score = 34.3 bits (77), Expect = 3.2
Identities = 17/50 (34%), Positives = 29/50 (58%)
Frame = +2

Query: 29 SQAYIHAQSVLINNLQESFDSYHNLIEERLLDLTKKIATVSFPRVQPSAW 178
+Q Y + +++NN +E H+L++ERLL++T +S QP AW
Sbjct: 78 NQGYPNIAYMVVNNREERSQRLHHLLQERLLNITLYAQDLS----QPDAW 123


>tr|Q97HF6|Q97HF6_CLOAB Predicted transcriptional regulator
OS=Clostridium acetobutylicum GN=CA_C2055 PE=4 SV=1
Length = 136

Score = 32.7 bits (73), Expect = 9.3
Identities = 18/63 (28%), Positives = 36/63 (57%)
Frame = -3

Query: 313 SLRPLSSIMCCRVQRGSQMGLEDSILK*SIKLVKRGKLPREELIGPSRRLDSRKGNGSNL 134
+L LS+ CR+++GS+ G+E+ + +KL + KL ++ L+ + LD+ +
Sbjct: 33 TLSDLSNTTICRIEKGSENGIENPDAETVVKLAEGLKLEKKALLIAAGYLDNENVEETTD 92

Query: 133 LRE 125
L+E
Sbjct: 93 LKE 95