BP919693
Clone id YMU001_000128_A11
Library
Length 497
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000128_A11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAATGGGCCATCAACAACATCTCGCTCGCGGTCACCCGTCGACCCGTTCTTACCTGGGC
TCAAATTTGCACTTACGGACGCCGTGGACTCAACGCCTCCGCCCATCACCTACCCCACGC
ACACCTACGACATCTTCTCTCCCCCCAAAAACCCTAATGCGAGATTTGGCACCCAAGTCT
ACAGATTCCCCCTTAATTCCACTGTGGACTTCATCTTGCAAAATGCTAACACACTGACCG
TCAACAACAGCGAGGTCCACCCCTGGCACATCCACGGTCACGATTTCTGGGTGCTCGGCT
ATGGCCCCGGGGCTTTTGATCCTACCGTGCATCCCCAGACATTCAACCTCAAGAACCCTC
CTCTCCGCAACACGGTCCCCCTTTACCCCTACGGCTGGACGGCCATTCGCTTTGTAGCTG
ACAATCCAGGAGTATGGCCCTTCCACTGTCACTTGGAGTCGCATTTTCACATGGGCATGG
GCATTGTCTTTGCGCAA
■■Homology search results ■■ -
sp_hit_id P14133
Definition sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus
Align length 154
Score (bit) 192.0
E-value 2.0e-50
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919693|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_A11.
(497 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1 ... 192 2e-50
sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=A... 188 2e-48
sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var. m... 187 2e-48
sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=... 176 3e-44
sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica... 121 2e-27
sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC1... 119 8e-27
sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC1... 119 1e-26
sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica G... 118 2e-26
sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 P... 116 5e-26
sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC1... 116 7e-26
sp|Q9FLB5|LAC12_ARATH Laccase-12 OS=Arabidopsis thaliana GN=LAC1... 116 7e-26
sp|Q0IQU1|LAC22_ORYSJ Laccase-22 OS=Oryza sativa subsp. japonica... 115 1e-25
sp|Q9LMS3|LAC1_ARATH Laccase-1 OS=Arabidopsis thaliana GN=LAC1 P... 113 6e-25
sp|Q9LFD1|LAC9_ARATH Laccase-9 OS=Arabidopsis thaliana GN=LAC9 P... 112 7e-25
sp|Q9SIY8|LAC5_ARATH Laccase-5 OS=Arabidopsis thaliana GN=LAC5 P... 112 9e-25
sp|Q9FJD5|LAC17_ARATH Laccase-17 OS=Arabidopsis thaliana GN=LAC1... 112 9e-25
sp|Q0DHL2|LAC12_ORYSJ Laccase-12/13 OS=Oryza sativa subsp. japon... 112 1e-24
sp|Q9FY79|LAC14_ARATH Laccase-14 OS=Arabidopsis thaliana GN=LAC1... 111 2e-24
sp|Q2QYS3|LAC23_ORYSJ Laccase-23 OS=Oryza sativa subsp. japonica... 110 4e-24
sp|Q0DHL5|LAC11_ORYSJ Putative laccase-11 OS=Oryza sativa subsp.... 110 4e-24
sp|Q5N9X2|LAC4_ORYSJ Laccase-4 OS=Oryza sativa subsp. japonica G... 109 6e-24
sp|Q2RBK2|LAC17_ORYSJ Putative laccase-17 OS=Oryza sativa subsp.... 109 6e-24
sp|Q9LFD2|LAC8_ARATH Laccase-8 OS=Arabidopsis thaliana GN=LAC8 P... 109 8e-24
sp|Q2QUN2|LAC24_ORYSJ Laccase-24 OS=Oryza sativa subsp. japonica... 108 1e-23
sp|Q5N7B4|LAC7_ORYSJ Laccase-7 OS=Oryza sativa subsp. japonica G... 108 2e-23
sp|Q941X2|LAC3_ORYSJ Laccase-3 OS=Oryza sativa subsp. japonica G... 108 2e-23
sp|O81081|LAC2_ARATH Laccase-2 OS=Arabidopsis thaliana GN=LAC2 P... 107 2e-23
sp|Q6ID18|LAC10_ARATH Laccase-10 OS=Arabidopsis thaliana GN=LAC1... 106 7e-23
sp|O80434|LAC4_ARATH Laccase-4 OS=Arabidopsis thaliana GN=IRX12 ... 105 9e-23
sp|Q9ZPY2|LAC6_ARATH Laccase-6 OS=Arabidopsis thaliana GN=LAC6 P... 105 1e-22

>sp|P14133|ASO_CUCSA L-ascorbate oxidase OS=Cucumis sativus PE=1
SV=1
Length = 587

Score = 192 bits (488), Expect(2) = 2e-50
Identities = 88/154 (57%), Positives = 102/154 (66%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +K L A + DI +PP NP G VY+F + TVD I
Sbjct: 407 PPTPYLAAMKMRLNTAFNQNPPPETFPLNY-DINNPPPNPETTTGNGVYKFNMGETVDVI 465

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N SE+HPWH+HGHDFWVLGYG G F + NLKNPPLRNTV ++PYG
Sbjct: 466 LQNANMLNPNMSEIHPWHLHGHDFWVLGYGEGKFYAPEDEKKLNLKNPPLRNTVVIFPYG 525

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTAIRFVADNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 526 WTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAE 559



Score = 26.9 bits (58), Expect(2) = 2e-50
Identities = 11/17 (64%), Positives = 13/17 (76%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAINN+SLA+ P L
Sbjct: 396 KWAINNVSLALPPTPYL 412


>sp|P24792|ASO_CUCMA L-ascorbate oxidase OS=Cucurbita maxima GN=AAO
PE=1 SV=2
Length = 579

Score = 188 bits (477), Expect(2) = 2e-48
Identities = 87/154 (56%), Positives = 102/154 (66%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +KF L A D DI +PP N + G VY+F + VD I
Sbjct: 402 PPTPYLGAMKFNLLHAFDQNPPPEVFPEDY-DIDTPPTNEKTKIGNGVYQFKIGEIVDVI 460

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN + N SE+HPWH+HGHDFWVLGYG G F + NLKNPPLRNTV ++PYG
Sbjct: 461 LQNANMMKENLSEIHPWHLHGHDFWVLGYGDGKFTAE-EESSLNLKNPPLRNTVVIFPYG 519

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTAIRFVADNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 520 WTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAE 553



Score = 25.0 bits (53), Expect(2) = 2e-48
Identities = 10/17 (58%), Positives = 13/17 (76%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAIN++SLA+ P L
Sbjct: 391 KWAINDVSLALPPTPYL 407


>sp|P37064|ASO_CUCPM L-ascorbate oxidase OS=Cucurbita pepo var.
melopepo PE=1 SV=1
Length = 552

Score = 187 bits (476), Expect(2) = 2e-48
Identities = 87/154 (56%), Positives = 101/154 (65%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +K+ L A D DI +PP N R G VY+F + VD I
Sbjct: 372 PPTPYLGAMKYNLLHAFDQNPPPEVFPEDY-DIDTPPTNEKTRIGNGVYQFKIGEVVDVI 430

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN + N SE HPWH+HGHDFWVLGYG G F + NLKNPPLRNTV ++PYG
Sbjct: 431 LQNANMMKENLSETHPWHLHGHDFWVLGYGDGKFSAE-EESSLNLKNPPLRNTVVIFPYG 489

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTAIRFVADNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 490 WTAIRFVADNPGVWAFHCHIEPHLHMGMGVVFAE 523



Score = 25.0 bits (53), Expect(2) = 2e-48
Identities = 10/17 (58%), Positives = 13/17 (76%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAIN++SLA+ P L
Sbjct: 361 KWAINDVSLALPPTPYL 377


>sp|Q40588|ASO_TOBAC L-ascorbate oxidase OS=Nicotiana tabacum GN=AAO
PE=2 SV=1
Length = 578

Score = 176 bits (445), Expect(2) = 3e-44
Identities = 73/123 (59%), Positives = 90/123 (73%)
Frame = +3

Query: 129 DIFSPPKNPNARFGTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGP 308
D+ N N+ +G VY N+T+D ILQNAN L + SE+HPWH+HGHDFWVLGYG
Sbjct: 429 DVLKQAPNSNSTYGNGVYMLKFNTTIDIILQNANALAKDVSEIHPWHLHGHDFWVLGYGE 488

Query: 309 GAFDPTVHPQTFNLKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGMGIV 488
G F + FNLKNPPLRNT ++P+GWTA+RFV DNPGVW FHCH+E H HMGMG++
Sbjct: 489 GKFSEK-DVKKFNLKNPPLRNTAVIFPFGWTALRFVTDNPGVWAFHCHIEPHLHMGMGVI 547

Query: 489 FAQ 497
FA+
Sbjct: 548 FAE 550



Score = 23.1 bits (48), Expect(2) = 3e-44
Identities = 8/11 (72%), Positives = 10/11 (90%)
Frame = +2

Query: 2 KWAINNISLAV 34
KWAINN+SL +
Sbjct: 389 KWAINNVSLVL 399


>sp|Q10ND7|LAC10_ORYSJ Laccase-10 OS=Oryza sativa subsp. japonica
GN=LAC10 PE=2 SV=1
Length = 578

Score = 121 bits (304), Expect = 2e-27
Identities = 57/114 (50%), Positives = 74/114 (64%)
Frame = +3

Query: 138 SPPKNPNARFGTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAF 317
+PP N N GT+V P N++V+ +LQ+ + L +E HP H+HG DF+V+G G G +
Sbjct: 442 TPPNNTNVSNGTRVVVLPYNASVEVVLQDTSIL---GAESHPLHLHGFDFFVVGQGTGNY 498

Query: 318 DPTVHPQTFNLKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGM 479
DP+ HP FNL +P RNTV + GW AIRF ADNPGVW HCHLE H G+
Sbjct: 499 DPSKHPAEFNLVDPVQRNTVGVPAGGWVAIRFFADNPGVWFMHCHLEVHTTWGL 552


>sp|Q9LYQ2|LAC13_ARATH Laccase-13 OS=Arabidopsis thaliana GN=LAC13
PE=2 SV=1
Length = 569

Score = 119 bits (298), Expect = 8e-27
Identities = 52/108 (48%), Positives = 71/108 (65%)
Frame = +3

Query: 168 GTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFN 347
GT+ Y+ NS V ILQ+ + +T N HP H+HG++F+V+G G G F+P +FN
Sbjct: 443 GTKAYKLKFNSQVQIILQDTSIVTTEN---HPMHLHGYEFYVVGTGVGNFNPNTDTSSFN 499

Query: 348 LKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGMGIVF 491
L +PP RNT+ P GW AIRFVA+NPG W HCH++SH G+ +VF
Sbjct: 500 LIDPPRRNTIGTPPGGWVAIRFVANNPGAWLMHCHIDSHIFWGLAMVF 547


>sp|Q8VZA1|LAC11_ARATH Laccase-11 OS=Arabidopsis thaliana GN=LAC11
PE=2 SV=1
Length = 557

Score = 119 bits (297), Expect = 1e-26
Identities = 56/108 (51%), Positives = 73/108 (67%)
Frame = +3

Query: 168 GTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFN 347
GT++ R N+T++ +LQ+ N LTV E HP+H+HG++F+V+G G G FDP P FN
Sbjct: 431 GTRLSRVKFNTTIELVLQDTNLLTV---ESHPFHLHGYNFFVVGTGVGNFDPKKDPAKFN 487

Query: 348 LKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGMGIVF 491
L +PP RNTV + GW AIRF ADNPGVW HCHLE H G+ + F
Sbjct: 488 LVDPPERNTVGVPTGGWAAIRFRADNPGVWFMHCHLEVHTMWGLKMAF 535


>sp|Q8RYM9|LAC2_ORYSJ Laccase-2 OS=Oryza sativa subsp. japonica
GN=LAC2 PE=2 SV=1
Length = 562

Score = 118 bits (295), Expect = 2e-26
Identities = 55/108 (50%), Positives = 74/108 (68%)
Frame = +3

Query: 168 GTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFN 347
GT++ + N+TV+ +LQ+ N L+V E HP+H+HG++F+V+G G G FDP P +N
Sbjct: 436 GTRLSKIAYNATVELVLQDTNLLSV---ESHPFHLHGYNFFVVGRGVGNFDPAKDPAKYN 492

Query: 348 LKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGMGIVF 491
L +PP RNTV + GWTAIRF ADNPGVW HCHLE H G+ + F
Sbjct: 493 LVDPPERNTVGVPAGGWTAIRFRADNPGVWFLHCHLEVHTSWGLKMAF 540


>sp|Q56YT0|LAC3_ARATH Laccase-3 OS=Arabidopsis thaliana GN=LAC3 PE=2
SV=2
Length = 570

Score = 116 bits (291), Expect = 5e-26
Identities = 52/108 (48%), Positives = 69/108 (63%)
Frame = +3

Query: 168 GTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFN 347
GT+ Y+ S V +LQ+ + +T N HP H+HG+ F+V+G G G F+P P FN
Sbjct: 444 GTKAYKLKYKSNVQIVLQDTSIVTPEN---HPMHLHGYQFYVVGSGFGNFNPRTDPARFN 500

Query: 348 LKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGMGIVF 491
L +PP RNT+ P GW AIRFVADNPG W HCH++SH G+ +VF
Sbjct: 501 LFDPPERNTIGTPPGGWVAIRFVADNPGAWFMHCHIDSHLGWGLAMVF 548


>sp|Q1PDH6|LAC16_ARATH Laccase-16 OS=Arabidopsis thaliana GN=LAC16
PE=2 SV=2
Length = 566

Score = 116 bits (290), Expect = 7e-26
Identities = 54/108 (50%), Positives = 72/108 (66%)
Frame = +3

Query: 168 GTQVYRFPLNSTVDFILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFN 347
GT++YR P N+TV +LQN + +N HP+H+HG +F+ +G G G F+P P+ FN
Sbjct: 440 GTKLYRLPYNATVQIVLQNTAMILSDN---HPFHLHGFNFFEVGRGLGNFNPEKDPKAFN 496

Query: 348 LKNPPLRNTVPLYPYGWTAIRFVADNPGVWPFHCHLESHFHMGMGIVF 491
L +P RNTV + GWTAIRF+ADNPGVW HCHLE H G+ + F
Sbjct: 497 LVDPVERNTVGVPAGGWTAIRFIADNPGVWFMHCHLELHTTWGLKMAF 544


tr_hit_id B3IWI2
Definition tr|B3IWI2|B3IWI2_BRARC Ascorbic acid oxidase OS=Brassica rapa subsp. chinensis
Align length 154
Score (bit) 203.0
E-value 3.0e-52
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919693|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_A11.
(497 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B3IWI2|B3IWI2_BRARC Ascorbic acid oxidase OS=Brassica rapa su... 203 3e-52
tr|Q8LPL3|Q8LPL3_ARATH Ascorbate oxidase-like protein (L-ascorba... 202 1e-51
tr|B8LLM3|B8LLM3_PICSI Putative uncharacterized protein OS=Picea... 201 3e-51
tr|Q9M5B4|Q9M5B4_CUCME Ascorbate oxidase AO4 OS=Cucumis melo PE=... 198 4e-51
tr|Q9SDV8|Q9SDV8_BRAJU Ascorbate oxidase (Fragment) OS=Brassica ... 199 5e-51
tr|Q9SDV7|Q9SDV7_BRAJU Ascorbate oxidase (Fragment) OS=Brassica ... 201 2e-50
tr|A9PII8|A9PII8_POPTR Putative uncharacterized protein OS=Popul... 194 2e-49
tr|O24093|O24093_MEDTR L-ascorbate oxidase OS=Medicago truncatul... 193 3e-49
tr|O04947|O04947_ARATH Ascorbate oxidase (Fragment) OS=Arabidops... 193 3e-49
tr|Q94A37|Q94A37_ARATH AT5g21100/T10F18_130 OS=Arabidopsis thali... 193 3e-49
tr|Q0WN00|Q0WN00_ARATH Putative uncharacterized protein OS=Arabi... 193 3e-49
tr|A9RBN4|A9RBN4_PHYPA Predicted protein OS=Physcomitrella paten... 194 4e-49
tr|Q5Z645|Q5Z645_ORYSJ Os06g0567200 protein OS=Oryza sativa subs... 194 8e-49
tr|A3BCV9|A3BCV9_ORYSJ Putative uncharacterized protein OS=Oryza... 194 8e-49
tr|Q9M5B5|Q9M5B5_CUCME Ascorbate oxidase AO1 OS=Cucumis melo PE=... 191 2e-48
tr|Q9ZR61|Q9ZR61_CUCME L-ascorbate oxidase (Fragment) OS=Cucumis... 191 2e-48
tr|Q8LJU3|Q8LJU3_SOYBN Ascorbate oxidase (Fragment) OS=Glycine m... 192 2e-48
tr|Q9ZR60|Q9ZR60_CUCME L-ascorbate oxidase (Fragment) OS=Cucumis... 193 3e-48
tr|A9SAC3|A9SAC3_PHYPA Predicted protein OS=Physcomitrella paten... 192 6e-48
tr|Q8S8Z5|Q8S8Z5_SOYBN Syringolide-induced protein B13-1-1 (Frag... 192 7e-48
tr|Q4VDN6|Q4VDN6_SOLLC Ascorbate oxidase OS=Solanum lycopersicum... 192 1e-47
tr|Q9M685|Q9M685_CAPAN Ascorbic acid oxidase (Fragment) OS=Capsi... 191 1e-47
tr|A7PG74|A7PG74_VITVI Chromosome chr6 scaffold_15, whole genome... 186 3e-47
tr|Q9SDV9|Q9SDV9_BRAJU Ascorbate oxidase (Fragment) OS=Brassica ... 186 3e-47
tr|A5AGG0|A5AGG0_VITVI Putative uncharacterized protein OS=Vitis... 186 3e-47
tr|A7R858|A7R858_VITVI Chromosome undetermined scaffold_2292, wh... 188 9e-47
tr|A7PL57|A7PL57_VITVI Chromosome chr7 scaffold_20, whole genome... 188 1e-46
tr|Q69QG3|Q69QG3_ORYSJ Putative syringolide-induced protein B13-... 182 2e-45
tr|Q0J296|Q0J296_ORYSJ Os09g0365900 protein OS=Oryza sativa subs... 182 2e-45
tr|B8BEW5|B8BEW5_ORYSI Putative uncharacterized protein OS=Oryza... 182 2e-45

>tr|B3IWI2|B3IWI2_BRARC Ascorbic acid oxidase OS=Brassica rapa
subsp. chinensis GN=BcAAO PE=2 SV=1
Length = 577

Score = 203 bits (516), Expect(2) = 3e-52
Identities = 90/154 (58%), Positives = 106/154 (68%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +K+ L D D+ +PP+N N G +Y FP N TVD I
Sbjct: 397 PATPYLGSVKYKLRRGFDRKSPPTTFPMDY-DVMNPPRNRNTTKGNGIYVFPFNVTVDVI 455

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N SE+HPWH+HGHDFWVLGYG G F P + +T+NLKNPPLRNTV LYPYG
Sbjct: 456 LQNANGLDANASEIHPWHLHGHDFWVLGYGEGKFRPEIDEKTYNLKNPPLRNTVALYPYG 515

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTA+RFV DNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 516 WTALRFVTDNPGVWFFHCHIEPHLHMGMGVVFAE 549



Score = 26.2 bits (56), Expect(2) = 3e-52
Identities = 10/17 (58%), Positives = 12/17 (70%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWA+NN+SL V P L
Sbjct: 386 KWALNNVSLVVPATPYL 402


>tr|Q8LPL3|Q8LPL3_ARATH Ascorbate oxidase-like protein (L-ascorbate
oxidase, putative) OS=Arabidopsis thaliana GN=At5g21100
PE=2 SV=1
Length = 573

Score = 202 bits (513), Expect(2) = 1e-51
Identities = 90/154 (58%), Positives = 103/154 (66%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
PV P+L +++ L A D DI PP NPN G+ +Y F VD I
Sbjct: 390 PVTPYLGSIRYGLKSAYDLKSPAKKLIMDNYDIMKPPPNPNTTKGSGIYNFAFGIVVDVI 449

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L SE+HPWHIHGHDFWVLGYG G F P + +TFNLKNPPLRNTV LYP+G
Sbjct: 450 LQNANVLKGVISEIHPWHIHGHDFWVLGYGEGKFKPGIDEKTFNLKNPPLRNTVVLYPFG 509

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTAIRFV DNPGVW FHCH+E H HMGMG+VF +
Sbjct: 510 WTAIRFVTDNPGVWFFHCHIEPHLHMGMGVVFVE 543



Score = 25.4 bits (54), Expect(2) = 1e-51
Identities = 10/17 (58%), Positives = 13/17 (76%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KW+INN+SL+V P L
Sbjct: 379 KWSINNVSLSVPVTPYL 395


>tr|B8LLM3|B8LLM3_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 574

Score = 201 bits (510), Expect(2) = 3e-51
Identities = 86/154 (55%), Positives = 107/154 (69%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P++ LK+ L++A D DI PP NPNA G +Y N+TVD +
Sbjct: 398 PATPYMASLKYKLSNAFDHRAAPETYSPNSYDIMRPPSNPNAATGNSIYSLDFNATVDLV 457

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N+S++HPWH+HGHDFWVL YG GAF+P+ + FNL+NP L+NTV L+PYG
Sbjct: 458 LQNANILMPNSSDIHPWHLHGHDFWVLAYGNGAFNPSEDFRKFNLRNPALQNTVVLFPYG 517

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTAIRFVADN G W FHCH+E H HMGMG+VFA+
Sbjct: 518 WTAIRFVADNAGAWAFHCHIEPHLHMGMGVVFAE 551



Score = 25.0 bits (53), Expect(2) = 3e-51
Identities = 9/17 (52%), Positives = 12/17 (70%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAINN+SL + P +
Sbjct: 387 KWAINNVSLVLPATPYM 403


>tr|Q9M5B4|Q9M5B4_CUCME Ascorbate oxidase AO4 OS=Cucumis melo PE=2
SV=1
Length = 587

Score = 198 bits (504), Expect(2) = 4e-51
Identities = 88/154 (57%), Positives = 105/154 (68%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +KF L+ A + DI +PP+NP G VY+F + TVD I
Sbjct: 407 PPTPYLAAMKFRLSTAFNQNPPPETFPIDY-DINNPPRNPETATGNGVYKFNMGETVDVI 465

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N SE+HPWH+HGHDFWVLGYG G F + NLKNPPLRNTV ++PYG
Sbjct: 466 LQNANMLNANTSEIHPWHLHGHDFWVLGYGEGKFSAAEDGRKLNLKNPPLRNTVVIFPYG 525

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTAIRFVADNPGVW FHCH+E H HMGMG++FA+
Sbjct: 526 WTAIRFVADNPGVWAFHCHIEPHLHMGMGVIFAE 559



Score = 26.9 bits (58), Expect(2) = 4e-51
Identities = 11/17 (64%), Positives = 13/17 (76%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAINN+SLA+ P L
Sbjct: 396 KWAINNVSLALPPTPYL 412


>tr|Q9SDV8|Q9SDV8_BRAJU Ascorbate oxidase (Fragment) OS=Brassica
juncea PE=2 SV=1
Length = 574

Score = 199 bits (505), Expect(2) = 5e-51
Identities = 90/154 (58%), Positives = 105/154 (68%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L K+ L D DI +PP+N N G +Y FP N TVD I
Sbjct: 394 PATPYLGSGKYRLRRGFDRKSPPTTFPVDY-DIMNPPRNRNTTKGNGIYVFPFNVTVDVI 452

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N SE+HPWH+HGHDFWVLGYG G F P V +T+NLKNPPL+NTV L+PYG
Sbjct: 453 LQNANGLDANASEIHPWHLHGHDFWVLGYGEGKFRPGVDEKTYNLKNPPLKNTVALFPYG 512

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTA+RFV DNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 513 WTALRFVTDNPGVWFFHCHIEPHLHMGMGVVFAE 546



Score = 26.2 bits (56), Expect(2) = 5e-51
Identities = 10/17 (58%), Positives = 12/17 (70%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWA+NN+SL V P L
Sbjct: 383 KWALNNVSLVVPATPYL 399


>tr|Q9SDV7|Q9SDV7_BRAJU Ascorbate oxidase (Fragment) OS=Brassica
juncea PE=2 SV=1
Length = 573

Score = 201 bits (510), Expect = 2e-50
Identities = 90/154 (58%), Positives = 106/154 (68%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +K+ L D DI +PP+N N G +Y FP N TVD I
Sbjct: 393 PATPYLGSVKYRLRRGFDRKSPPTTFPVDY-DIMNPPRNRNTTKGNGIYVFPFNVTVDVI 451

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N SE+HPWH+HGHDFWVLGYG G F P V +T+NLKNPPL+NTV L+PYG
Sbjct: 452 LQNANGLDANASEIHPWHLHGHDFWVLGYGEGKFRPGVDEKTYNLKNPPLKNTVALFPYG 511

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTA+RFV DNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 512 WTALRFVTDNPGVWFFHCHIEPHLHMGMGVVFAE 545


>tr|A9PII8|A9PII8_POPTR Putative uncharacterized protein OS=Populus
trichocarpa PE=2 SV=1
Length = 594

Score = 194 bits (492), Expect(2) = 2e-49
Identities = 88/154 (57%), Positives = 104/154 (67%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L ++F L DA D D+ PP NPN G+ VY STVD I
Sbjct: 414 PATPYLGSIRFGLRDAFDQTKPPEDFPGHY-DVMKPPVNPNTTTGSGVYMLGYYSTVDVI 472

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN LT N SE+HPWH+HGHDFWVLGYG G F + + FNLKNPP RNT ++PYG
Sbjct: 473 LQNANALTENVSEIHPWHLHGHDFWVLGYGEGKFTKS-DEKKFNLKNPPYRNTAVIFPYG 531

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTA+RFVADNPGVW FHCH+E H H+GMG+VFA+
Sbjct: 532 WTALRFVADNPGVWAFHCHIEPHLHLGMGVVFAE 565



Score = 25.8 bits (55), Expect(2) = 2e-49
Identities = 9/17 (52%), Positives = 13/17 (76%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KW+INN+SL++ P L
Sbjct: 403 KWSINNVSLSIPATPYL 419


>tr|O24093|O24093_MEDTR L-ascorbate oxidase OS=Medicago truncatula
GN=MtN23 PE=2 SV=1
Length = 569

Score = 193 bits (491), Expect(2) = 3e-49
Identities = 87/154 (56%), Positives = 101/154 (65%)
Frame = +3

Query: 36 PVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDFI 215
P P+L +KF L + D DIF P NPN G VY F LN VD I
Sbjct: 395 PTTPYLGSIKFNLKNTFDKNPPPERFPMDY-DIFKNPVNPNTTTGNGVYTFQLNEVVDVI 453

Query: 216 LQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPYG 395
LQNAN L N SE+HPWH+HGHDFWVLGYG G F P V ++FNL PLRNT ++PYG
Sbjct: 454 LQNANQLNGNGSEIHPWHLHGHDFWVLGYGEGRFRPGVDERSFNLTRAPLRNTAVIFPYG 513

Query: 396 WTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
WTA+RF ADNPGVW FHCH+E H HMGMG++FA+
Sbjct: 514 WTALRFKADNPGVWAFHCHIEPHLHMGMGVIFAE 547



Score = 25.8 bits (55), Expect(2) = 3e-49
Identities = 10/17 (58%), Positives = 12/17 (70%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAINN+SL + P L
Sbjct: 384 KWAINNVSLTLPTTPYL 400


>tr|O04947|O04947_ARATH Ascorbate oxidase (Fragment) OS=Arabidopsis
thaliana PE=2 SV=1
Length = 567

Score = 193 bits (491), Expect(2) = 3e-49
Identities = 88/155 (56%), Positives = 104/155 (67%)
Frame = +3

Query: 33 SPVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDF 212
+P P+L +K+ L + DI +PP PN G +Y FP N TVD
Sbjct: 386 TPATPYLGSVKYNLKLGFNRKSPPRSYRMDY-DIMNPPPFPNTTTGNGIYVFPFNVTVDV 444

Query: 213 ILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPY 392
I+QNAN L SE+HPWH+HGHDFWVLGYG G F P + +T+NLKNPPLRNT LYPY
Sbjct: 445 IIQNANVLKGIVSEIHPWHLHGHDFWVLGYGDGKFKPGIDEKTYNLKNPPLRNTAILYPY 504

Query: 393 GWTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
GWTAIRFV DNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 505 GWTAIRFVTDNPGVWFFHCHIEPHLHMGMGVVFAE 539



Score = 25.4 bits (54), Expect(2) = 3e-49
Identities = 10/17 (58%), Positives = 11/17 (64%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAINN+SL P L
Sbjct: 376 KWAINNVSLVTPATPYL 392


>tr|Q94A37|Q94A37_ARATH AT5g21100/T10F18_130 OS=Arabidopsis thaliana
PE=2 SV=1
Length = 530

Score = 193 bits (491), Expect(2) = 3e-49
Identities = 88/155 (56%), Positives = 104/155 (67%)
Frame = +3

Query: 33 SPVDPFLPGLKFALTDAVDSXXXXXXXXXXXXDIFSPPKNPNARFGTQVYRFPLNSTVDF 212
+P P+L +K+ L + DI +PP PN G +Y FP N TVD
Sbjct: 349 TPATPYLGSVKYNLKLGFNRKSPPRSYRMDY-DIMNPPPFPNTTTGNGIYVFPFNVTVDV 407

Query: 213 ILQNANTLTVNNSEVHPWHIHGHDFWVLGYGPGAFDPTVHPQTFNLKNPPLRNTVPLYPY 392
I+QNAN L SE+HPWH+HGHDFWVLGYG G F P + +T+NLKNPPLRNT LYPY
Sbjct: 408 IIQNANVLKGIVSEIHPWHLHGHDFWVLGYGDGKFKPGIDEKTYNLKNPPLRNTAILYPY 467

Query: 393 GWTAIRFVADNPGVWPFHCHLESHFHMGMGIVFAQ 497
GWTAIRFV DNPGVW FHCH+E H HMGMG+VFA+
Sbjct: 468 GWTAIRFVTDNPGVWFFHCHIEPHLHMGMGVVFAE 502



Score = 25.4 bits (54), Expect(2) = 3e-49
Identities = 10/17 (58%), Positives = 11/17 (64%)
Frame = +2

Query: 2 KWAINNISLAVTRRPVL 52
KWAINN+SL P L
Sbjct: 339 KWAINNVSLVTPATPYL 355