BP919717
Clone id YMU001_000128_D01
Library
Length 387
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000128_D01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GAATATTACCTGCAGGTACTCCATTTTGGGGGCCTTAATTAAAAGTGATATGTCGACTTG
AAAGTTTTTTCTACACAAAAGGAGAAGAAGTGTGGAAAACCCCATGTAATGCTTTTTTCT
TGGGTTTCCTTAAAATGTGTTGAACAATGGATAGTGTCTTTTAATAAGCAAGTGATTCGT
TTTATCAACAAACACAAGTTTGAAACTACCTTACCTCAATAGGATTAGACTTTGTTGCGT
GAATCATAAAACAAACCTCGTGTACTTTTATGTGAACTAAGCATACTTTGAGGAAAGGTC
ATGATCTGCCCATTTCTCAGAGGTTCTGATTCATGGAAAATTTTTGAATGGGATGTTAAA
GATGATGGACAAGGTCGCTTTCCCCTA
■■Homology search results ■■ -
sp_hit_id Q3BVP1
Definition sp|Q3BVP1|SYM_XANC5 Methionyl-tRNA synthetase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10)
Align length 33
Score (bit) 28.9
E-value 8.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919717|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_D01.
(387 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q3BVP1|SYM_XANC5 Methionyl-tRNA synthetase OS=Xanthomonas cam... 29 8.4

>sp|Q3BVP1|SYM_XANC5 Methionyl-tRNA synthetase OS=Xanthomonas
campestris pv. vesicatoria (strain 85-10) GN=metG PE=3
SV=1
Length = 694

Score = 28.9 bits (63), Expect = 8.4
Identities = 13/33 (39%), Positives = 20/33 (60%)
Frame = +1

Query: 274 ELSIL*GKVMICPFLRGSDSWKIFEWDVKDDGQ 372
+L + GKV++C F+ GSD FE D + G+
Sbjct: 594 KLDLRIGKVLVCEFVEGSDKLLRFELDAGELGK 626


tr_hit_id A0BDG5
Definition tr|A0BDG5|A0BDG5_PARTE Chromosome undetermined scaffold_100, whole genome shotgun sequence OS=Paramecium tetraurelia
Align length 64
Score (bit) 34.3
E-value 3.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919717|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_D01.
(387 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A0BDG5|A0BDG5_PARTE Chromosome undetermined scaffold_100, who... 34 3.2

>tr|A0BDG5|A0BDG5_PARTE Chromosome undetermined scaffold_100, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00027610001 PE=4 SV=1
Length = 1420

Score = 34.3 bits (77), Expect = 3.2
Identities = 23/64 (35%), Positives = 34/64 (53%), Gaps = 4/64 (6%)
Frame = -1

Query: 186 DKTNHLLIKRHYPLFNTF*GNPRKKHYMGFSTL---LLLLCRKNFQ-VDISLLIKAPKME 19
DK H+L+KRH+ FNT N +H+ FS L +L+ R N Q + S L+ K
Sbjct: 1144 DKYKHMLLKRHFSQFNTMMDN-NIQHFFQFSELYEYILITMRNNDQYIYYSELLNEDKSI 1202

Query: 18 YLQV 7
Y+ +
Sbjct: 1203 YMMM 1206