BP919729
Clone id YMU001_000128_E02
Library
Length 423
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000128_E02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CTTCAAAGCCTCAGCATCCACTTCCAAACCCTCTTGACGAGCAATTATCTGCAGCCTATT
CACAACATCATTCTCCTTGATCTTCGAAAAAATGAATTTCTGACATCTCGAGATAACTGC
ATGAGGCAACTGCTCCAAGCTGCTAGTGCACAACACAAAGACAACATTTTTGGGAGCTTC
TTCCACAGCTTTCATGAACGCATTCCAAGAATGAGTTGAAAGAATATGACATTCATCCAC
AATAAACACTCTATAACGGAAGGAGACAGCTCTTGTCACTTCATGAATCATCTTTTTCAT
GCCTTTTGTACTCTGAAGCCCACCTGCTGTGAATTCTTTCAAAATAGAGGTTTTCCCAAA
CTTATGTGCTAAGCATTCTGAGCACGACCCACATGGCTTCAGTTTGTCAGCTGATGTACA
GTT
■■Homology search results ■■ -
sp_hit_id P47658
Definition sp|P47658|DPO3X_MYCGE DNA polymerase III subunit gamma/tau OS=Mycoplasma genitalium
Align length 141
Score (bit) 97.1
E-value 3.0e-20
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919729|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_E02.
(423 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P47658|DPO3X_MYCGE DNA polymerase III subunit gamma/tau OS=My... 97 3e-20
sp|P09122|DPO3X_BACSU DNA polymerase III subunit gamma/tau OS=Ba... 89 7e-18
sp|Q89A95|DPO3X_BUCBP DNA polymerase III subunit gamma OS=Buchne... 89 9e-18
sp|P43746|DPO3X_HAEIN DNA polymerase III subunit gamma/tau OS=Ha... 88 1e-17
sp|Q8K983|DPO3X_BUCAP DNA polymerase III subunit gamma OS=Buchne... 87 3e-17
sp|P57553|DPO3X_BUCAI DNA polymerase III subunit gamma OS=Buchne... 85 1e-16
sp|P06710|DPO3X_ECOLI DNA polymerase III subunit tau OS=Escheric... 84 2e-16
sp|P74876|DPO3X_SALTY DNA polymerase III subunit tau OS=Salmonel... 83 4e-16
sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau OS=My... 82 1e-15
sp|P63975|DPO3X_MYCTU DNA polymerase III subunit gamma/tau OS=My... 75 1e-13
sp|P63976|DPO3X_MYCBO DNA polymerase III subunit gamma/tau OS=My... 75 1e-13
sp|A3DNV9|RFCS_STAMF Replication factor C small subunit OS=Staph... 58 1e-08
sp|O57852|RFCS_PYRHO Replication factor C small subunit OS=Pyroc... 52 1e-06
sp|Q8U4J3|RFCS_PYRFU Replication factor C small subunit OS=Pyroc... 52 1e-06
sp|O74111|RFC3_ARXAD Replication factor C subunit 3 OS=Arxula ad... 52 1e-06
sp|Q9UXF5|RFCS_SULSO Replication factor C small subunit OS=Sulfo... 51 2e-06
sp|Q2NH89|RFCS_METST Replication factor C small subunit OS=Metha... 51 2e-06
sp|Q5JHP2|RFCS_PYRKO Replication factor C small subunit OS=Pyroc... 51 2e-06
sp|Q5UZE5|RFCS_HALMA Replication factor C small subunit OS=Haloa... 50 5e-06
sp|A1RSA2|RFCS1_PYRIL Replication factor C small subunit 1 OS=Py... 49 8e-06
sp|A1RWU7|RFCS_THEPD Replication factor C small subunit OS=Therm... 48 1e-05
sp|A3MS28|RFCS_PYRCJ Replication factor C small subunit OS=Pyrob... 48 2e-05
sp|Q8ZYK4|RFCS1_PYRAE Replication factor C small subunit 1 OS=Py... 48 2e-05
sp|O26343|RFCS_METTH Replication factor C small subunit OS=Metha... 47 2e-05
sp|P37540|HOLB_BACSU DNA polymerase III subunit delta' OS=Bacill... 47 2e-05
sp|A4WGV2|RFCS1_PYRAR Replication factor C small subunit 1 OS=Py... 47 3e-05
sp|Q975D3|RFCS_SULTO Replication factor C small subunit OS=Sulfo... 47 4e-05
sp|Q4JAB0|RFCS_SULAC Replication factor C small subunit OS=Sulfo... 47 4e-05
sp|Q8TZC4|RFCS_METKA Replication factor C small subunit OS=Metha... 46 5e-05
sp|Q9YBS7|RFCS_AERPE Replication factor C small subunit OS=Aerop... 46 5e-05

>sp|P47658|DPO3X_MYCGE DNA polymerase III subunit gamma/tau
OS=Mycoplasma genitalium GN=dnaX PE=3 SV=3
Length = 597

Score = 97.1 bits (240), Expect = 3e-20
Identities = 43/141 (30%), Positives = 80/141 (56%), Gaps = 1/141 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEV-TRAVSFRYRV 247
NC + D++ C SC C + + E A +++++ V +F+ +V
Sbjct: 62 NCLNWDQIDVCNSCDVCKSINTNSAIDIVEIDAASKNGINDIRELVENVFNHPFTFKKKV 121

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+I+DE H+L+T SW +K +EE+P V+F+ T+ ++P ++SRCQ F F KI +
Sbjct: 122 YILDEAHMLTTQSWGGLLKTLEESPPYVLFIFTTTEFNKIPLTILSRCQSFFFKKITSDL 181

Query: 66 VVNRLQIIARQEGLEVDAEAL 4
++ RL IA++E ++++ +AL
Sbjct: 182 ILERLNDIAKKEKIKIEKDAL 202


>sp|P09122|DPO3X_BACSU DNA polymerase III subunit gamma/tau
OS=Bacillus subtilis GN=dnaX PE=3 SV=2
Length = 563

Score = 89.0 bits (219), Expect = 7e-18
Identities = 47/144 (32%), Positives = 80/144 (55%), Gaps = 3/144 (2%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAG---GLQSTKGMKKMIHEVTRAVSFRY 253
NC A +PC C+ C G S + E A G+ + ++ + AV+ Y
Sbjct: 63 NCEHAPVDEPCNECAACKGITNGSISDVIEIDAASNNGVDEIRDIRDKVKFAPSAVT--Y 120

Query: 252 RVFIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKE 73
+V+I+DE H+LS ++NA +K +EE P++ +F+L T+ ++P +ISRCQ+F F +I
Sbjct: 121 KVYIIDEVHMLSIGAFNALLKTLEEPPEHCIFILATTEPHKIPLTIISRCQRFDFKRITS 180

Query: 72 NDVVNRLQIIARQEGLEVDAEALK 1
+V R+ I E L+V+ +L+
Sbjct: 181 QAIVGRMNKIVDAEQLQVEEGSLE 204


>sp|Q89A95|DPO3X_BUCBP DNA polymerase III subunit gamma OS=Buchnera
aphidicola subsp. Baizongia pistaciae GN=dnaX PE=3 SV=1
Length = 370

Score = 88.6 bits (218), Expect = 9e-18
Identities = 43/141 (30%), Positives = 79/141 (56%), Gaps = 1/141 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVSF-RYRV 247
NC PC CS C+ + G L E A + MK+++ + S R+++
Sbjct: 63 NCKLGISPNPCRKCSNCVEVEQGNFIDLYEVDAASRTKVEDMKELLDNIRYLPSKGRFKI 122

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+++DE H+LS +S+N +K +EE P+++ F+L T++LE++P ++SRC +F I N+
Sbjct: 123 YLIDEVHMLSRYSFNFLLKNIEEPPQHIKFILATTNLEKIPDTILSRCLQFQLKPINLNE 182

Query: 66 VVNRLQIIARQEGLEVDAEAL 4
+V + I +E + + +AL
Sbjct: 183 IVACISNILHKENITYEIKAL 203


>sp|P43746|DPO3X_HAEIN DNA polymerase III subunit gamma/tau
OS=Haemophilus influenzae GN=dnaX PE=3 SV=1
Length = 688

Score = 88.2 bits (217), Expect = 1e-17
Identities = 46/141 (32%), Positives = 74/141 (52%), Gaps = 1/141 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVT-RAVSFRYRV 247
NC PCG C C A + G L E A + ++++ V + V R++V
Sbjct: 63 NCVHGVTATPCGECENCKAIEQGNFIDLIEIDAASRTKVEDTRELLDNVQYKPVVGRFKV 122

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+++DE H+LS HS+NA +K +EE P+ V F+L T+ ++LP ++SRC +F + E
Sbjct: 123 YLIDEVHMLSRHSFNALLKTLEEPPEYVKFLLATTDPQKLPVTILSRCLQFHLKALDETQ 182

Query: 66 VVNRLQIIARQEGLEVDAEAL 4
+ L I QE + + AL
Sbjct: 183 ISQHLAHILTQENIPFEDPAL 203


>sp|Q8K983|DPO3X_BUCAP DNA polymerase III subunit gamma OS=Buchnera
aphidicola subsp. Schizaphis graminum GN=dnaX PE=3 SV=1
Length = 363

Score = 87.0 bits (214), Expect = 3e-17
Identities = 45/142 (31%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVS-FRYRV 247
NC PC C+ C + G E A + +++++ + S R++V
Sbjct: 63 NCEIGITSLPCRKCTICQEIEKGICLDFIEIDAASRTKVEEIREILDNIYYTPSKSRFKV 122

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+++DE H+LS HS+NA +K +EE P+++ F+L T+ +E++P + SRC F + + E D
Sbjct: 123 YLIDEVHMLSRHSFNALLKTLEEPPQHIKFILATTDVEKIPKTIRSRCLHFKLNILSEED 182

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+ N L+ I ++ G D EALK
Sbjct: 183 IFNFLKHILKKGGNNFDEEALK 204


>sp|P57553|DPO3X_BUCAI DNA polymerase III subunit gamma OS=Buchnera
aphidicola subsp. Acyrthosiphon pisum GN=dnaX PE=3 SV=1
Length = 361

Score = 84.7 bits (208), Expect = 1e-16
Identities = 43/142 (30%), Positives = 77/142 (54%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRA-VSFRYRV 247
NC + PC C C + G + E + M++++ + + + R++V
Sbjct: 63 NCQNGITSDPCRQCIICKEIEKGLCLDVIEIDGASRTKVEEMREILDSIYYSPIKSRFKV 122

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+++DE H+LS HS+NA +K +EE P++V FVL T+ ++++P +ISRC F I E
Sbjct: 123 YLIDEVHMLSRHSFNALLKTLEEPPEHVKFVLATTDVDRIPKTIISRCLYFKLQIISEEK 182

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+ L+ I +E ++ D +LK
Sbjct: 183 IFKFLKYILIKESIDTDEYSLK 204


>sp|P06710|DPO3X_ECOLI DNA polymerase III subunit tau OS=Escherichia
coli (strain K12) GN=dnaX PE=1 SV=1
Length = 643

Score = 84.0 bits (206), Expect = 2e-16
Identities = 43/142 (30%), Positives = 78/142 (54%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVSF-RYRV 247
NC + PCG C C + G+ L E A + + ++ V A + R++V
Sbjct: 63 NCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKV 122

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+++DE H+LS HS+NA +K +EE P++V F+L T+ ++LP ++SRC +F +
Sbjct: 123 YLIDEVHMLSRHSFNALLKTLEEPPEHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQ 182

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+ ++L+ I +E + + AL+
Sbjct: 183 IRHQLEHILNEEHIAHEPRALQ 204


>sp|P74876|DPO3X_SALTY DNA polymerase III subunit tau OS=Salmonella
typhimurium GN=dnaX PE=3 SV=2
Length = 642

Score = 83.2 bits (204), Expect = 4e-16
Identities = 43/142 (30%), Positives = 77/142 (54%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVSF-RYRV 247
NC + PCG C C + G+ L E A + + ++ V A + R++V
Sbjct: 63 NCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTKVEDTRDLLDNVQYAPARGRFKV 122

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
+++DE H+LS HS+NA +K +EE P +V F+L T+ ++LP ++SRC +F +
Sbjct: 123 YLIDEVHMLSRHSFNALLKTLEEPPAHVKFLLATTDPQKLPVTILSRCLQFHLKALDVEQ 182

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+ ++L+ I +E + + AL+
Sbjct: 183 IRHQLEHILNEEHIAHEPRALQ 204


>sp|P75177|DPO3X_MYCPN DNA polymerase III subunit gamma/tau
OS=Mycoplasma pneumoniae GN=dnaX PE=3 SV=1
Length = 681

Score = 81.6 bits (200), Expect = 1e-15
Identities = 38/131 (29%), Positives = 68/131 (51%), Gaps = 1/131 (0%)
Frame = -1

Query: 393 CGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRA-VSFRYRVFIVDECHILS 217
C C C A + E A ++++ V F+ +V+I+DE H+L+
Sbjct: 71 CNQCEACQAINSNSAIDVFEIDAASKNGINDIRELAENVFNLPFKFKKKVYILDEAHMLT 130

Query: 216 THSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKENDVVNRLQIIAR 37
SW+ +K +EEAP V+F+ T+ ++P ++SRCQ F F +I + + RL +A
Sbjct: 131 PQSWSGLLKTLEEAPDYVLFIFATTEFNKIPITILSRCQSFFFKQITNDLIQQRLAEVAA 190

Query: 36 QEGLEVDAEAL 4
+E +++ +AL
Sbjct: 191 KESIKITTDAL 201


>sp|P63975|DPO3X_MYCTU DNA polymerase III subunit gamma/tau
OS=Mycobacterium tuberculosis GN=dnaX PE=3 SV=1
Length = 578

Score = 74.7 bits (182), Expect = 1e-13
Identities = 44/141 (31%), Positives = 72/141 (51%), Gaps = 5/141 (3%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLA---HKFGKTSILKEFTA--GGLQSTKGMKKMIHEVTRAVSF 259
NC PCG C C++ + G +++ A GG+ T+ ++ V
Sbjct: 60 NCAQGPTANPCGVCESCVSLAPNAPGSIDVVELDAASHGGVDDTRELRDRAFYAP--VQS 117

Query: 258 RYRVFIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKI 79
RYRVFIVDE H+++T +NA +K VEE P++++F+ T+ E++ + SR + F +
Sbjct: 118 RYRVFIVDEAHMVTTAGFNALLKIVEEPPEHLIFIFATTEPEKVLPTIRSRTHHYPFRLL 177

Query: 78 KENDVVNRLQIIARQEGLEVD 16
+ L I QEG+ VD
Sbjct: 178 PPRTMRALLARICEQEGVVVD 198


tr_hit_id A7QDG1
Definition tr|A7QDG1|A7QDG1_VITVI Chromosome chr10 scaffold_81, whole genome shotgun sequence OS=Vitis vinifera
Align length 142
Score (bit) 127.0
E-value 2.0e-28
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919729|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_E02.
(423 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QDG1|A7QDG1_VITVI Chromosome chr10 scaffold_81, whole genom... 127 2e-28
tr|Q9SN33|Q9SN33_ARATH Putative uncharacterized protein F28A21.2... 124 2e-27
tr|Q75K66|Q75K66_ORYSJ Os05g0529600 protein OS=Oryza sativa subs... 124 3e-27
tr|B8B072|B8B072_ORYSI Putative uncharacterized protein OS=Oryza... 124 3e-27
tr|A3B639|A3B639_ORYSJ Putative uncharacterized protein OS=Oryza... 124 3e-27
tr|A9TL38|A9TL38_PHYPA Predicted protein (Fragment) OS=Physcomit... 120 3e-26
tr|Q53M12|Q53M12_ORYSJ ATPase, AAA family protein OS=Oryza sativ... 120 4e-26
tr|B8BJV7|B8BJV7_ORYSI Putative uncharacterized protein OS=Oryza... 120 4e-26
tr|Q5JNF0|Q5JNF0_ORYSJ Putative DNA polymerase III subunit gamma... 119 7e-26
tr|B8A913|B8A913_ORYSI Putative uncharacterized protein OS=Oryza... 119 7e-26
tr|A7QCE6|A7QCE6_VITVI Chromosome undetermined scaffold_77, whol... 119 7e-26
tr|A5B4C6|A5B4C6_VITVI Putative uncharacterized protein OS=Vitis... 119 7e-26
tr|A3ANG4|A3ANG4_ORYSJ Putative uncharacterized protein OS=Oryza... 119 7e-26
tr|Q9FK71|Q9FK71_ARATH Similarity to DNA polymerase III OS=Arabi... 119 1e-25
tr|Q2QW40|Q2QW40_ORYSJ Os12g0209300 protein OS=Oryza sativa subs... 118 2e-25
tr|A9RJS6|A9RJS6_PHYPA Predicted protein (Fragment) OS=Physcomit... 118 2e-25
tr|A2ZIZ6|A2ZIZ6_ORYSI Putative uncharacterized protein OS=Oryza... 118 2e-25
tr|O64728|O64728_ARATH Similar to prokaryotic DNA polymerase III... 115 8e-25
tr|Q9M9R7|Q9M9R7_ARATH F14L17.24 protein OS=Arabidopsis thaliana... 114 2e-24
tr|A7PCL7|A7PCL7_VITVI Chromosome chr17 scaffold_12, whole genom... 114 3e-24
tr|A3CGJ3|A3CGJ3_ORYSJ Putative uncharacterized protein OS=Oryza... 112 7e-24
tr|A2ZJN8|A2ZJN8_ORYSI Putative uncharacterized protein OS=Oryza... 112 7e-24
tr|Q81JC0|Q81JC0_BACCR DNA polymerase III subunit gamma/tau OS=B... 107 4e-22
tr|B7HIJ1|B7HIJ1_BACCE DNA polymerase III, gamma and tau subunit... 107 4e-22
tr|Q73FI6|Q73FI6_BACC1 DNA polymerase III, gamma and tau subunit... 106 5e-22
tr|B7R6S6|B7R6S6_9THEO DNA polymerase III, subunits gamma and ta... 106 5e-22
tr|B7HPT4|B7HPT4_BACCE DNA polymerase III, gamma and tau subunit... 106 5e-22
tr|B5VCY9|B5VCY9_BACCE DNA polymerase III, gamma and tau subunit... 106 5e-22
tr|Q81W18|Q81W18_BACAN DNA polymerase III, gamma and tau subunit... 106 6e-22
tr|Q6HPZ2|Q6HPZ2_BACHK DNA polymerase III, gamma and tau subunit... 106 6e-22

>tr|A7QDG1|A7QDG1_VITVI Chromosome chr10 scaffold_81, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00035826001
PE=4 SV=1
Length = 982

Score = 127 bits (320), Expect = 2e-28
Identities = 61/142 (42%), Positives = 91/142 (64%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRA-VSFRYRV 247
NC S + KPCG C+ C+AH GK+ ++E +G+ ++ V + + +YRV
Sbjct: 409 NCPSMEHPKPCGFCNSCIAHDMGKSRNIREVGPVSNLDFEGIMNLLDNVIASQLPTQYRV 468

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FI D+C LS W+A K ++ AP+ +VFVL +S+L+ LPH +ISRCQKF F K+K+ D
Sbjct: 469 FIFDDCDTLSPDCWSAISKLIDRAPRRMVFVLVSSTLDVLPHIIISRCQKFFFPKLKDAD 528

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
++ LQ IA +E LE+D +ALK
Sbjct: 529 IIYTLQWIATKEDLEIDKDALK 550


>tr|Q9SN33|Q9SN33_ARATH Putative uncharacterized protein F28A21.230
(Putative uncharacterized protein AT4g18820)
OS=Arabidopsis thaliana GN=F28A21.230 PE=2 SV=1
Length = 1057

Score = 124 bits (311), Expect = 2e-27
Identities = 63/142 (44%), Positives = 90/142 (63%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVSFRYRVF 244
NC S ++ KPCG+CS C++H GK+ ++E G + + ++ S RVF
Sbjct: 490 NCHSMEQPKPCGTCSSCVSHDMGKSWNIREVGPVGNYDFEKIMDLLDGNVMVSSQSPRVF 549

Query: 243 IVDECHILSTHSWNAFMKAVEEA-PKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
I D+C LS+ WNA K V+ A P++VVF+L SSL+ LPH +ISRCQKF F K+K+ D
Sbjct: 550 IFDDCDTLSSDCWNALSKVVDRAAPRHVVFILVCSSLDVLPHVIISRCQKFFFPKLKDAD 609

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+V LQ IA +E +E+D +ALK
Sbjct: 610 IVYSLQWIASKEEIEIDKDALK 631


>tr|Q75K66|Q75K66_ORYSJ Os05g0529600 protein OS=Oryza sativa subsp.
japonica GN=OJ1131_E09.4 PE=4 SV=1
Length = 1023

Score = 124 bits (310), Expect = 3e-27
Identities = 62/142 (43%), Positives = 90/142 (63%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRA-VSFRYRV 247
NC S + +PC SC+ C+AH GK+ L E G + ++ V + V ++RV
Sbjct: 413 NCHSPEHPRPCDSCASCIAHNLGKSRSLVEIGPVGNIDLDSIVDILDNVMLSPVPTQHRV 472

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FIVD+C+ L +W+ K +E AP+ VVF+L + +L+ LPH ++SRCQKF F K+KE D
Sbjct: 473 FIVDDCNTLPPDTWSVISKVIERAPRRVVFILISPNLD-LPHIIVSRCQKFFFPKLKECD 531

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+VN LQ I+ EGL+VD +ALK
Sbjct: 532 IVNTLQWISTSEGLDVDRDALK 553


>tr|B8B072|B8B072_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_20723 PE=4 SV=1
Length = 1079

Score = 124 bits (310), Expect = 3e-27
Identities = 62/142 (43%), Positives = 90/142 (63%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRA-VSFRYRV 247
NC S + +PC SC+ C+AH GK+ L E G + ++ V + V ++RV
Sbjct: 413 NCHSPEHPRPCDSCASCIAHNLGKSRSLVEIGPVGNIDLDSIVDILDNVMLSPVPTQHRV 472

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FIVD+C+ L +W+ K +E AP+ VVF+L + +L+ LPH ++SRCQKF F K+KE D
Sbjct: 473 FIVDDCNTLPPDTWSVISKVIERAPRRVVFILISPNLD-LPHIIVSRCQKFFFPKLKECD 531

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+VN LQ I+ EGL+VD +ALK
Sbjct: 532 IVNTLQWISTSEGLDVDRDALK 553


>tr|A3B639|A3B639_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_018511 PE=4 SV=1
Length = 1011

Score = 124 bits (310), Expect = 3e-27
Identities = 62/142 (43%), Positives = 90/142 (63%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRA-VSFRYRV 247
NC S + +PC SC+ C+AH GK+ L E G + ++ V + V ++RV
Sbjct: 401 NCHSPEHPRPCDSCASCIAHNLGKSRSLVEIGPVGNIDLDSIVDILDNVMLSPVPTQHRV 460

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FIVD+C+ L +W+ K +E AP+ VVF+L + +L+ LPH ++SRCQKF F K+KE D
Sbjct: 461 FIVDDCNTLPPDTWSVISKVIERAPRRVVFILISPNLD-LPHIIVSRCQKFFFPKLKECD 519

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+VN LQ I+ EGL+VD +ALK
Sbjct: 520 IVNTLQWISTSEGLDVDRDALK 541


>tr|A9TL38|A9TL38_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_1129 PE=4 SV=1
Length = 356

Score = 120 bits (302), Expect = 3e-26
Identities = 59/141 (41%), Positives = 90/141 (63%), Gaps = 1/141 (0%)
Frame = -1

Query: 423 NCTSADKLK-PCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVSFRYRV 247
NC S D+ + PCG C EC K +++ +++ A M+ M+ T +Y+V
Sbjct: 66 NCLSPDRARRPCGICRECGTMKLNRSADVRQIDAASNIDAASMRAMMGSFTPHA--QYKV 123

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FIV+ C +LS+ WNAF+K +EE P+NVVF+L T+ E++P SRCQKF FSK+K+ D
Sbjct: 124 FIVEGCDLLSSDIWNAFLKVLEEPPRNVVFILITTDAERIPSTAFSRCQKFHFSKLKDAD 183

Query: 66 VVNRLQIIARQEGLEVDAEAL 4
+V+RL+++A +E L V+ AL
Sbjct: 184 IVSRLELLATKEDLHVEVGAL 204


>tr|Q53M12|Q53M12_ORYSJ ATPase, AAA family protein OS=Oryza sativa
subsp. japonica GN=LOC_Os11g13990 PE=4 SV=1
Length = 1121

Score = 120 bits (300), Expect = 4e-26
Identities = 63/141 (44%), Positives = 89/141 (63%), Gaps = 1/141 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEV-TRAVSFRYRV 247
+C + + KPCG+C EC G L E A +S ++ +I + A S RY+V
Sbjct: 394 SCVAIGENKPCGACMECTDFFTGNGINLIEVDASNRKSINRIRHLIENIPASATSSRYKV 453

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
F+VDECH++S+ W+AFMK ++E VVF+ T E LP AVISRCQK++FSKIK+ D
Sbjct: 454 FVVDECHMVSSKVWSAFMKFLDEPLPRVVFIFITIDPENLPRAVISRCQKYMFSKIKDID 513

Query: 66 VVNRLQIIARQEGLEVDAEAL 4
+V RL+ IA +E L+V+ AL
Sbjct: 514 IVCRLRKIAVKENLDVELAAL 534


>tr|B8BJV7|B8BJV7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35669 PE=4 SV=1
Length = 860

Score = 120 bits (300), Expect = 4e-26
Identities = 63/141 (44%), Positives = 89/141 (63%), Gaps = 1/141 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEV-TRAVSFRYRV 247
+C + + KPCG+C EC G L E A +S ++ +I + A S RY+V
Sbjct: 147 SCVAIGENKPCGACMECTDFFTGNGINLIEVDASNRKSINRIRHLIENIPASATSSRYKV 206

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
F+VDECH++S+ W+AFMK ++E VVF+ T E LP AVISRCQK++FSKIK+ D
Sbjct: 207 FVVDECHMVSSKVWSAFMKFLDEPLPRVVFIFITIDPENLPRAVISRCQKYMFSKIKDID 266

Query: 66 VVNRLQIIARQEGLEVDAEAL 4
+V RL+ IA +E L+V+ AL
Sbjct: 267 IVCRLRKIAVKENLDVELAAL 287


>tr|Q5JNF0|Q5JNF0_ORYSJ Putative DNA polymerase III subunit
gamma/tau (Os01g0730900 protein) OS=Oryza sativa subsp.
japonica GN=P0435H01.30 PE=4 SV=1
Length = 622

Score = 119 bits (298), Expect = 7e-26
Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVS-FRYRV 247
NC S + +PC SC+ C+AH GK+ + E G G+ ++ V + + YRV
Sbjct: 409 NCHSPEHPRPCDSCTSCIAHNLGKSRSVMEIGPVGNIDMDGIVDVLDNVMLSPAPSHYRV 468

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FI D+C L +W+ K V+ AP+ VVF+L + +L+ LPH ++SRCQKF F K+KE D
Sbjct: 469 FIFDDCDTLPADTWSLISKVVDRAPRRVVFILVSPNLD-LPHIILSRCQKFFFPKLKECD 527

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+VN LQ I+ E L+VD +ALK
Sbjct: 528 IVNTLQWISTSESLDVDRDALK 549


>tr|B8A913|B8A913_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_03625 PE=4 SV=1
Length = 815

Score = 119 bits (298), Expect = 7e-26
Identities = 60/142 (42%), Positives = 87/142 (61%), Gaps = 1/142 (0%)
Frame = -1

Query: 423 NCTSADKLKPCGSCSECLAHKFGKTSILKEFTAGGLQSTKGMKKMIHEVTRAVS-FRYRV 247
NC S + +PC SC+ C+AH GK+ + E G G+ ++ V + + YRV
Sbjct: 175 NCHSPEHPRPCDSCTSCIAHNLGKSRSVMEIGPVGNIDMDGIVDVLDNVMLSPAPSHYRV 234

Query: 246 FIVDECHILSTHSWNAFMKAVEEAPKNVVFVLCTSSLEQLPHAVISRCQKFIFSKIKEND 67
FI D+C L +W+ K V+ AP+ VVF+L + +L+ LPH ++SRCQKF F K+KE D
Sbjct: 235 FIFDDCDTLPADTWSLISKVVDRAPRRVVFILVSPNLD-LPHIILSRCQKFFFPKLKECD 293

Query: 66 VVNRLQIIARQEGLEVDAEALK 1
+VN LQ I+ E L+VD +ALK
Sbjct: 294 IVNTLQWISTSESLDVDRDALK 315