BP919763
Clone id YMU001_000128_H04
Library
Length 291
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000128_H04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAAGAGACCATATGCATCGATTATTAGGGGGAGCCACCCCAAACAACAACAGACCATAGA
TTTGGGCTTTACAAGGAGCCCATACCCAATACAATAGGACATGCGACATCAAATACATCC
AAAAAACACTTGGCTAGTAAGGGAGCCACCCTGCATATCAATCAAGAGAAGCAAAAGGCA
AGCTAACCTCGGCTACCACAGAAGCATCTCCATCTGCAAGCACCTCCTTTGAAGGAAAAC
CGCCAATAATGTTGCAAAATGGGCGCGGCTCGAGGTCCCCACATCGGCTTG
■■Homology search results ■■ -
sp_hit_id O41801
Definition sp|O41801|TAT_HV19N Protein Tat OS=Human immunodeficiency virus type 1 (isolate 92NG083 group M subtype G)
Align length 39
Score (bit) 30.8
E-value 2.2
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919763|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_H04.
(291 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O41801|TAT_HV19N Protein Tat OS=Human immunodeficiency virus ... 31 2.2
sp|O89943|TAT_HV1SE Protein Tat OS=Human immunodeficiency virus ... 30 4.8
sp|O12161|TAT_HV192 Protein Tat OS=Human immunodeficiency virus ... 30 4.8

>sp|O41801|TAT_HV19N Protein Tat OS=Human immunodeficiency virus
type 1 (isolate 92NG083 group M subtype G) PE=3 SV=1
Length = 101

Score = 30.8 bits (68), Expect = 2.2
Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHAT-SNTSKKHLASKGAT 150
PQ + DH+ + K+P+P T G+ T S KK +ASK T
Sbjct: 59 PQGSKDHQNPVPKQPLPITSGNPTGSEKPKKEVASKTET 97


>sp|O89943|TAT_HV1SE Protein Tat OS=Human immunodeficiency virus
type 1 (isolate SE6165 group M subtype G) PE=3 SV=1
Length = 101

Score = 29.6 bits (65), Expect = 4.8
Identities = 15/36 (41%), Positives = 23/36 (63%), Gaps = 1/36 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASK 141
PQ++ H+ + K+P+P T G+ T SKK +ASK
Sbjct: 59 PQSSKGHQDPVPKQPLPTTRGNPTGPKESKKEVASK 94


>sp|O12161|TAT_HV192 Protein Tat OS=Human immunodeficiency virus
type 1 (isolate 92BR025 group M subtype C) GN=tat PE=3
SV=1
Length = 101

Score = 29.6 bits (65), Expect = 4.8
Identities = 16/39 (41%), Positives = 23/39 (58%), Gaps = 1/39 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHAT-SNTSKKHLASKGAT 150
P ++ DH+ + K+P+P T G T S SKK + SK T
Sbjct: 59 PPSSEDHQNPIPKQPLPQTRGDQTGSEESKKKVESKTET 97


tr_hit_id Q1M0J4
Definition tr|Q1M0J4|Q1M0J4_9HIV1 Protein Tat OS=Human immunodeficiency virus 1
Align length 40
Score (bit) 36.2
E-value 0.84
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919763|Adiantum capillus-veneris mRNA, clone:
YMU001_000128_H04.
(291 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|Q1M0J4|Q1M0J4_9HIV1 Protein Tat OS=Human immunodeficiency vir... 36 0.84
tr|Q9IW40|Q9IW40_9HIV1 Protein Tat OS=Human immunodeficiency vir... 35 1.9
tr|B2YFV1|B2YFV1_9HIV1 Tat protein (Fragment) OS=Human immunodef... 35 1.9
tr|Q6X6W5|Q6X6W5_9HIV1 Protein Tat OS=Human immunodeficiency vir... 35 2.4
tr|Q50D73|Q50D73_9HIV1 Protein Tat OS=Human immunodeficiency vir... 35 2.4
tr|Q0PM95|Q0PM95_9HIV1 Protein Tat OS=Human immunodeficiency vir... 35 2.4
tr|B6D267|B6D267_9HIV1 Tat protein OS=Human immunodeficiency vir... 35 2.4
tr|Q2KMR6|Q2KMR6_9HIV1 Protein Tat OS=Human immunodeficiency vir... 34 3.2
tr|Q1M0K9|Q1M0K9_9HIV1 Protein Tat OS=Human immunodeficiency vir... 34 3.2
tr|Q1KW79|Q1KW79_9HIV1 Protein Tat OS=Human immunodeficiency vir... 34 3.2
tr|A1KY53|A1KY53_9HIV1 Protein Tat OS=Human immunodeficiency vir... 34 3.2
tr|Q998H4|Q998H4_9HIV1 Protein Tat OS=Human immunodeficiency vir... 34 4.1
tr|Q9IV15|Q9IV15_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UPQ8|Q8UPQ8_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UPQ0|Q8UPQ0_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UPP1|Q8UPP1_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UPN3|Q8UPN3_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UPM4|Q8UPM4_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UPL5|Q8UPL5_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q8UNK4|Q8UNK4_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q596Q0|Q596Q0_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q49IF9|Q49IF9_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|A8TV16|A8TV16_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|A8TUX8|A8TUX8_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|A8TUK3|A8TUK3_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 5.4
tr|Q7ZBG2|Q7ZBG2_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 7.1
tr|Q71AX9|Q71AX9_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 7.1
tr|Q9YUZ6|Q9YUZ6_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 9.2
tr|Q9WS48|Q9WS48_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 9.2
tr|Q8UTI4|Q8UTI4_9HIV1 Protein Tat OS=Human immunodeficiency vir... 33 9.2

>tr|Q1M0J4|Q1M0J4_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 101

Score = 36.2 bits (82), Expect = 0.84
Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 1/40 (2%)
Frame = +1

Query: 34 PPQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PPQ++ DH+ + ++P+P T G+ TS SKK +ASK T
Sbjct: 58 PPQSSKDHQNPVPEQPLPTTRGNPTSPKESKKKVASKAET 97


>tr|Q9IW40|Q9IW40_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 99

Score = 35.0 bits (79), Expect = 1.9
Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PQ+ DH+ + K+P+PNT G+ T SKK +ASK T
Sbjct: 59 PQSRPDHQNPVPKQPLPNTRGNPTGPKESKKKVASKAKT 97


>tr|B2YFV1|B2YFV1_9HIV1 Tat protein (Fragment) OS=Human
immunodeficiency virus 1 GN=tat PE=4 SV=1
Length = 61

Score = 35.0 bits (79), Expect = 1.9
Identities = 18/40 (45%), Positives = 24/40 (60%), Gaps = 1/40 (2%)
Frame = +1

Query: 34 PPQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PPQ+ DH+ + K+P P T G+ T SKK +ASK T
Sbjct: 18 PPQSRQDHQNPVPKQPFPTTRGNPTGPKESKKEVASKAET 57


>tr|Q6X6W5|Q6X6W5_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 101

Score = 34.7 bits (78), Expect = 2.4
Identities = 18/40 (45%), Positives = 25/40 (62%), Gaps = 1/40 (2%)
Frame = +1

Query: 34 PPQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PPQ++ DH+ + K+PIP T G +T SKK + SK T
Sbjct: 58 PPQSSKDHQNPIPKQPIPQTQGISTGPEESKKKVESKAET 97


>tr|Q50D73|Q50D73_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 100

Score = 34.7 bits (78), Expect = 2.4
Identities = 16/39 (41%), Positives = 24/39 (61%)
Frame = +1

Query: 34 PPQTTTDHRFGLYKEPIPNTIGHATSNTSKKHLASKGAT 150
PPQ+ DH+ + K+P+P+T G + SKK + SK T
Sbjct: 58 PPQSHQDHQNPVPKQPLPDTEGPTGTKESKKEVESKTKT 96


>tr|Q0PM95|Q0PM95_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 101

Score = 34.7 bits (78), Expect = 2.4
Identities = 17/40 (42%), Positives = 26/40 (65%), Gaps = 1/40 (2%)
Frame = +1

Query: 34 PPQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PPQ++ DH+ + ++P+P T G+ T SKK +ASK T
Sbjct: 58 PPQSSKDHQNPVPEQPLPTTRGNPTGPKESKKKVASKAET 97


>tr|B6D267|B6D267_9HIV1 Tat protein OS=Human immunodeficiency virus
1 GN=tat PE=4 SV=1
Length = 101

Score = 34.7 bits (78), Expect = 2.4
Identities = 17/39 (43%), Positives = 24/39 (61%), Gaps = 1/39 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PQ+ DH+ + K+P+P T G+ T SKK +ASK T
Sbjct: 59 PQSNKDHQIPVPKQPLPTTRGNQTGPEKSKKEVASKAET 97


>tr|Q2KMR6|Q2KMR6_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 101

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/36 (50%), Positives = 24/36 (66%), Gaps = 1/36 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASK 141
PQ++ DHR + K+PIP T G+ T SKK +ASK
Sbjct: 59 PQSSKDHRNPIPKQPIPATRGNPTGPEESKKEVASK 94


>tr|Q1M0K9|Q1M0K9_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 101

Score = 34.3 bits (77), Expect = 3.2
Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHATS-NTSKKHLASKGAT 150
PQ++TDH L ++P+P T G+ T SKK +ASK T
Sbjct: 59 PQSSTDHPHPLPEQPLPITRGNTTDPKESKKKVASKAET 97


>tr|Q1KW79|Q1KW79_9HIV1 Protein Tat OS=Human immunodeficiency virus
1 GN=tat PE=3 SV=1
Length = 101

Score = 34.3 bits (77), Expect = 3.2
Identities = 17/39 (43%), Positives = 26/39 (66%), Gaps = 1/39 (2%)
Frame = +1

Query: 37 PQTTTDHRFGLYKEPIPNTIGHAT-SNTSKKHLASKGAT 150
P ++TDH+ + K+P+P T G++T S SKK + SK T
Sbjct: 59 PPSSTDHQTPISKQPLPQTRGNSTGSEESKKKVESKTKT 97