BP919773
Clone id YMU001_000129_A04
Library
Length 557
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000129_A04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTAAAGGGAAGCTTCGATCAGTTTCATGTAATGTCCCCACACTATGACACAAACAGGCAG
CTGAACTTACTAACAATTTTCAGGAGACTTGGATATCCAGGATGACTTCATTCAATACCT
TCTATACCTTCTGCTTTTCAAACTTTCCTAGGACCTAAACTGTGTCTTACAAACAAGTAT
ACATAACCCATAAATGACTAAAGTGCACACTATATGGCACATTTGGAGTTGACCAGCAAG
TACATACTGGAACCAGGTAAACCCCTGTGCCTCTGTATTTTGGTACACGGTCCCCATGCC
TTCACAGCTGTTGTTCCAAGTAATCTTCAGTGCTGGAAGATTTTCGTGGAGATCCGCTGC
CGAGAAAGGCTCTGCTCAACCCACTAAGAGCCCATGGCAGCCATTTCTCCTGATGCTGAC
TCTCCTCTGCTAAATGTCTTTGTTTCTCCTCCTCCAAGAAATTCTGCCATTTCTCCTTCA
TGAAAACCATAACTGCTTCTGCTCCTGCCTCGGCAACTTCCACGGGCGGACTCACCAGTG
GATTGTCCTTCAAATGA
■■Homology search results ■■ -
sp_hit_id Q9DGQ7
Definition sp|Q9DGQ7|CDC37_TETFL Hsp90 co-chaperone Cdc37 OS=Tetraodon fluviatilis
Align length 61
Score (bit) 32.3
E-value 1.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919773|Adiantum capillus-veneris mRNA, clone:
YMU001_000129_A04.
(557 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9DGQ7|CDC37_TETFL Hsp90 co-chaperone Cdc37 OS=Tetraodon fluv... 32 1.6
sp|P12919|PDGFB_FELCA Platelet-derived growth factor subunit B O... 32 2.1
sp|A6NEL2|ANR56_HUMAN Ankyrin repeat domain-containing protein 5... 31 3.6
sp|Q5SXM2|SNPC4_HUMAN snRNA-activating protein complex subunit 4... 30 8.0

>sp|Q9DGQ7|CDC37_TETFL Hsp90 co-chaperone Cdc37 OS=Tetraodon
fluviatilis GN=cdc37 PE=3 SV=1
Length = 377

Score = 32.3 bits (72), Expect = 1.6
Identities = 21/61 (34%), Positives = 30/61 (49%), Gaps = 1/61 (1%)
Frame = -2

Query: 454 EEEKQRHLAEESQHQEKWLPWALSGLSR-AFLGSGSPRKSSSTEDYLEQQL*RHGDRVPK 278
EE EE H+EK +PW + LS+ F S K+ S ED E++ +H V +
Sbjct: 98 EERDWARKLEEHNHEEKKMPWNVDTLSKDGFSKSIVNVKADSAEDTEEEKEKKHKTFVER 157

Query: 277 Y 275
Y
Sbjct: 158 Y 158


>sp|P12919|PDGFB_FELCA Platelet-derived growth factor subunit B
OS=Felis silvestris catus GN=PDGFB PE=2 SV=1
Length = 245

Score = 32.0 bits (71), Expect = 2.1
Identities = 20/67 (29%), Positives = 33/67 (49%), Gaps = 3/67 (4%)
Frame = -1

Query: 452 GGETKTFSRGESASGEMAAMGS*WVEQSLSRQRISTKIFQ-H*RLLGTTAVK--AWGPCT 282
GGE ++ SRG + GE A + ++ + T++F+ RL+ T W PC
Sbjct: 70 GGELESLSRGRRSLGEAAGSPTVAEPAMIAECKTRTEVFEVSRRLIDRTNANFLVWPPCV 129

Query: 281 KIQRHRG 261
++QR G
Sbjct: 130 EVQRCSG 136


>sp|A6NEL2|ANR56_HUMAN Ankyrin repeat domain-containing protein 56
OS=Homo sapiens GN=ANKRD56 PE=2 SV=1
Length = 793

Score = 31.2 bits (69), Expect = 3.6
Identities = 19/51 (37%), Positives = 27/51 (52%), Gaps = 3/51 (5%)
Frame = -2

Query: 415 HQEKWLPWALSGLSRAFLGS---GSPRKSSSTEDYLEQQL*RHGDRVPKYR 272
H K LPW + L R+ S G + SSS E+YL++ L + R P+ R
Sbjct: 480 HPLKPLPWPVPKLRRSLRRSSLAGRAKLSSSDEEYLDEGLLKRSRRPPRSR 530


>sp|Q5SXM2|SNPC4_HUMAN snRNA-activating protein complex subunit 4
OS=Homo sapiens GN=SNAPC4 PE=1 SV=1
Length = 1469

Score = 30.0 bits (66), Expect = 8.0
Identities = 25/82 (30%), Positives = 36/82 (43%), Gaps = 2/82 (2%)
Frame = -2

Query: 472 KWQNFL-EEEKQRHLAEESQHQEKWLPWALSGLSRAFLG-SGSPRKSSSTEDYLEQQL*R 299
KW+ + +++ R ++H +W + SG S G S S SSS ED EQ
Sbjct: 494 KWKIMMGKKQGLRRRRRRARHSVRWSSTSSSGSSSGSSGGSSSSSSSSSEEDEPEQAQAG 553

Query: 298 HGDRVPKYRGTGVYLVPVCTCW 233
GDR + Y+VP W
Sbjct: 554 EGDRALL---SPQYMVPDMDLW 572


tr_hit_id A7PCS2
Definition tr|A7PCS2|A7PCS2_VITVI Chromosome chr17 scaffold_12, whole genome shotgun sequence OS=Vitis vinifera
Align length 92
Score (bit) 44.3
E-value 0.004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919773|Adiantum capillus-veneris mRNA, clone:
YMU001_000129_A04.
(557 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7PCS2|A7PCS2_VITVI Chromosome chr17 scaffold_12, whole genom... 44 0.004
tr|B8LQU6|B8LQU6_PICSI Putative uncharacterized protein OS=Picea... 44 0.008
tr|Q9LPV2|Q9LPV2_ARATH F13K23.23 protein OS=Arabidopsis thaliana... 43 0.013
tr|Q8W4Q3|Q8W4Q3_ARATH At1g12970/F13K23_18 (Plant intracellular ... 43 0.013
tr|B6TES9|B6TES9_MAIZE Protein lap1 OS=Zea mays PE=2 SV=1 40 0.11
tr|Q9FFJ3|Q9FFJ3_ARATH Genomic DNA, chromosome 5, P1 clone:MJJ3 ... 39 0.19
tr|Q9C769|Q9C769_ARATH Putative uncharacterized protein F11B9.22... 39 0.25
tr|Q8VYG9|Q8VYG9_ARATH Putative uncharacterized protein At3g1133... 39 0.25
tr|Q7XK44|Q7XK44_ORYSJ OSJNBa0044K18.1 protein OS=Oryza sativa s... 35 2.1
tr|Q0JCE1|Q0JCE1_ORYSJ Os04g0476700 protein (Fragment) OS=Oryza ... 35 2.1
tr|Q01IY1|Q01IY1_ORYSA OSIGBa0106G07.16 protein (OSIGBa0116M22.1... 35 2.1
tr|A3AUU7|A3AUU7_ORYSJ Putative uncharacterized protein OS=Oryza... 35 2.1
tr|A2XUM3|A2XUM3_ORYSI Putative uncharacterized protein OS=Oryza... 35 2.1
tr|Q63JM2|Q63JM2_BURPS FolC bifunctional protein [includes: foly... 35 3.6
tr|Q62AJ8|Q62AJ8_BURMA FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|Q3JKH9|Q3JKH9_BURP1 Folylpolyglutamate synthase/dihydrofolate... 35 3.6
tr|Q2T7G7|Q2T7G7_BURTA Folylpolyglutamate synthase/dihydrofolate... 35 3.6
tr|A3P7M6|A3P7M6_BURP0 FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A3NM64|A3NM64_BURP6 FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A3MBU8|A3MBU8_BURM7 FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A2S140|A2S140_BURM9 FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A1UZ44|A1UZ44_BURMS FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|B7CRN9|B7CRN9_BURPS FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|B1H7T4|B1H7T4_BURPS FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A9K4I4|A9K4I4_BURMA FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A8KDE2|A8KDE2_BURPS FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A8EP37|A8EP37_BURPS FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A5XLP6|A5XLP6_BURMA FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A5TND9|A5TND9_BURMA FolC bifunctional protein OS=Burkholderia... 35 3.6
tr|A5J4M2|A5J4M2_BURMA FolC bifunctional protein OS=Burkholderia... 35 3.6

>tr|A7PCS2|A7PCS2_VITVI Chromosome chr17 scaffold_12, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00015986001
PE=4 SV=1
Length = 500

Score = 44.3 bits (103), Expect = 0.004
Identities = 30/92 (32%), Positives = 43/92 (46%), Gaps = 8/92 (8%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEESQHQE--------KW 401
+L NPLV PP VFM ++W + L EE+Q+ L E + E W
Sbjct: 412 NLDQNPLVIPPMEVVNEGVEAVKVFMAKRWLDILVEEEQKSLLEVKEQTETGWLTRSTSW 471

Query: 400 LPWALSGLSRAFLGSGSPRKSSSTEDYLEQQL 305
L +SG+S++ G P + YL+QQL
Sbjct: 472 LGSVVSGVSQSVSGYLGP---GPRDPYLDQQL 500


>tr|B8LQU6|B8LQU6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 524

Score = 43.5 bits (101), Expect = 0.008
Identities = 26/94 (27%), Positives = 41/94 (43%), Gaps = 11/94 (11%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEES----QHQEKWLPWA 389
+L NPL++PP M ++W ++L EE+Q++++ S Q W+ W
Sbjct: 430 NLDQNPLMTPPNEIVVQGVEAVKEHMAKRWLDYLLEEEQKYMSANSNTNNQTNNGWVQWG 489

Query: 388 -------LSGLSRAFLGSGSPRKSSSTEDYLEQQ 308
+SG + G K E YLEQQ
Sbjct: 490 SSVFGGLISGTKESIRGYLGASKKPHMESYLEQQ 523


>tr|Q9LPV2|Q9LPV2_ARATH F13K23.23 protein OS=Arabidopsis thaliana
GN=F13K23.23 PE=4 SV=1
Length = 492

Score = 42.7 bits (99), Expect = 0.013
Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 6/90 (6%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEESQHQ---EKWLPWAL 386
+L NPL PP FM+++W+ +EEE+ R + E + Q WL W
Sbjct: 405 NLDQNPLEYPPQEMVNQSAEAVREFMRKRWEEMVEEEQLRSVIEAEKQQGGATGWLSWGS 464

Query: 385 SGLSRAFLG---SGSPRKSSSTEDYLEQQL 305
S ++ F G G+ +K ++ +L++QL
Sbjct: 465 SIVTSLFSGGTHGGAAKKPKNS--FLDEQL 492


>tr|Q8W4Q3|Q8W4Q3_ARATH At1g12970/F13K23_18 (Plant intracellular
Ras-group-related LRR protein 3) OS=Arabidopsis thaliana
GN=PIRL3 PE=2 SV=1
Length = 464

Score = 42.7 bits (99), Expect = 0.013
Identities = 26/90 (28%), Positives = 44/90 (48%), Gaps = 6/90 (6%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEESQHQ---EKWLPWAL 386
+L NPL PP FM+++W+ +EEE+ R + E + Q WL W
Sbjct: 377 NLDQNPLEYPPQEMVNQSAEAVREFMRKRWEEMVEEEQLRSVIEAEKQQGGATGWLSWGS 436

Query: 385 SGLSRAFLG---SGSPRKSSSTEDYLEQQL 305
S ++ F G G+ +K ++ +L++QL
Sbjct: 437 SIVTSLFSGGTHGGAAKKPKNS--FLDEQL 464


>tr|B6TES9|B6TES9_MAIZE Protein lap1 OS=Zea mays PE=2 SV=1
Length = 502

Score = 39.7 bits (91), Expect = 0.11
Identities = 28/90 (31%), Positives = 43/90 (47%), Gaps = 7/90 (7%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEE----SQHQEKWLPWA 389
+L+ NPLV PP +M ++W + L EE+QR +A E S + WL +
Sbjct: 413 NLEQNPLVMPPEDIVNKGVDAVKEYMSKRWLDILLEEEQRRIAAETPEMSSTPKAWLTRS 472

Query: 388 LS---GLSRAFLGSGSPRKSSSTEDYLEQQ 308
+S +S + G KS + YL+QQ
Sbjct: 473 VSWVTDVSESLAGYLGGNKSEK-DAYLDQQ 501


>tr|Q9FFJ3|Q9FFJ3_ARATH Genomic DNA, chromosome 5, P1 clone:MJJ3
(Putative uncharacterized protein At5g05850) (Plant
intracellular Ras-group-related LRR protein 1)
(At5g05850) OS=Arabidopsis thaliana GN=PIRL1 PE=2 SV=1
Length = 506

Score = 38.9 bits (89), Expect = 0.19
Identities = 30/92 (32%), Positives = 42/92 (45%), Gaps = 8/92 (8%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFL-EEEKQRHLAEE-SQHQEKWLPWALS 383
+L NPLV PP ++M ++W + L EEEK ++ +E Q WL S
Sbjct: 420 NLDQNPLVVPPDEVVKQGVDAVKMYMGKRWVSMLEEEEKMANMKDEMDQTNTDWLTRTTS 479

Query: 382 GLS------RAFLGSGSPRKSSSTEDYLEQQL 305
L +LGS PR + YL+QQL
Sbjct: 480 KLKTYVTEVSEYLGSNPPR-----DPYLDQQL 506


>tr|Q9C769|Q9C769_ARATH Putative uncharacterized protein F11B9.22
OS=Arabidopsis thaliana GN=F11B9.22 PE=4 SV=1
Length = 537

Score = 38.5 bits (88), Expect = 0.25
Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 7/91 (7%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEE-SQHQEKWLPWALSG 380
++ NPLV PP +M ++ + LEEE+++ + EE Q WL S
Sbjct: 452 NVDQNPLVVPPEEVVKEGVEAVKTYMGQRRISMLEEEEKKKMEEEMEQANAGWLTRTTSK 511

Query: 379 LS------RAFLGSGSPRKSSSTEDYLEQQL 305
L +LGS SPR + YLE+QL
Sbjct: 512 LKTYVADVSEYLGSNSPR-----DPYLERQL 537


>tr|Q8VYG9|Q8VYG9_ARATH Putative uncharacterized protein At3g11330
(Plant intracellular Ras-group-related LRR protein 9)
OS=Arabidopsis thaliana GN=PIRL9 PE=2 SV=1
Length = 499

Score = 38.5 bits (88), Expect = 0.25
Identities = 29/91 (31%), Positives = 42/91 (46%), Gaps = 7/91 (7%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEE-SQHQEKWLPWALSG 380
++ NPLV PP +M ++ + LEEE+++ + EE Q WL S
Sbjct: 414 NVDQNPLVVPPEEVVKEGVEAVKTYMGQRRISMLEEEEKKKMEEEMEQANAGWLTRTTSK 473

Query: 379 LS------RAFLGSGSPRKSSSTEDYLEQQL 305
L +LGS SPR + YLE+QL
Sbjct: 474 LKTYVADVSEYLGSNSPR-----DPYLERQL 499


>tr|Q7XK44|Q7XK44_ORYSJ OSJNBa0044K18.1 protein OS=Oryza sativa
subsp. japonica GN=OSJNBa0044K18.1 PE=4 SV=2
Length = 434

Score = 35.4 bits (80), Expect = 2.1
Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 8/91 (8%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEESQHQEKWLPWA---- 389
+L+ NPL PP +M ++W + L EE+++ +A Q P A
Sbjct: 343 NLEQNPLSMPPMEIVNKGVDAVKEYMLQRWLDILLEEERKSIAAAESPQAPTTPSAWLAR 402

Query: 388 ----LSGLSRAFLGSGSPRKSSSTEDYLEQQ 308
+S +S + +G S + + YL+QQ
Sbjct: 403 SVSWVSDVSGSLVGYLSGENKTEKDAYLDQQ 433


>tr|Q0JCE1|Q0JCE1_ORYSJ Os04g0476700 protein (Fragment) OS=Oryza
sativa subsp. japonica GN=Os04g0476700 PE=4 SV=1
Length = 271

Score = 35.4 bits (80), Expect = 2.1
Identities = 23/91 (25%), Positives = 40/91 (43%), Gaps = 8/91 (8%)
Frame = -2

Query: 556 HLKDNPLVSPPXXXXXXXXXXXXVFMKEKWQNFLEEEKQRHLAEESQHQEKWLPWA---- 389
+L+ NPL PP +M ++W + L EE+++ +A Q P A
Sbjct: 180 NLEQNPLSMPPMEIVNKGVDAVKEYMLQRWLDILLEEERKSIAAAESPQAPTTPSAWLAR 239

Query: 388 ----LSGLSRAFLGSGSPRKSSSTEDYLEQQ 308
+S +S + +G S + + YL+QQ
Sbjct: 240 SVSWVSDVSGSLVGYLSGENKTEKDAYLDQQ 270