BP919804 [AcEST]

BP919804
Clone id	YMU001_000129_D02
Library	YMU01
Length	242
Definition	Adiantum capillus-veneris mRNA. clone: YMU001_000129_D02.
Accession	BP919804
Tissue type	prothallium
Developmental stage	-
Contig ID	CL1786Contig1
Sequence	TGGTTAGCCATCCTCATGCGCACATTCGACTTGGATACCGCCTTGACCCCTGTTTCCTTC ATCGTAGCTTTTGTCATGACGCAAACCTGTGCTTCGCCATCAATATAGGCTTGAACCTGC ATCCTTTTCTCGATGATAGCATCCACCAAAGGAAGAACATCTGTCGGGCTACCTACCCTG AGTGCCATATTTTGAACCGCGTGCAAATTGCCTTTACCCCTTGGTAGCCTAGTGCTAACA CT
■■Homology search results ■■	-
Swiss-Prot (release 56.9)	Link to BlastX Result : Swiss-Prot
sp_hit_id	A9NFN6
Definition	sp\|A9NFN6\|HRCA_ACHLI Heat-inducible transcription repressor hrcA OS=Acholeplasma laidlawii (strain PG-8A)
Align length	38
Score (bit)	28.9
E-value	8.4
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP919804\|Adiantum capillus-veneris mRNA, clone: YMU001_000129_D02. (242 letters) Database: uniprot_sprot.fasta 412,525 sequences; 148,809,765 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp\|A9NFN6\|HRCA_ACHLI Heat-inducible transcription repressor hrcA... 29 8.4 sp\|Q8L3A0\|HRCA_ACHLA Heat-inducible transcription repressor hrcA... 29 8.4 >sp\|A9NFN6\|HRCA_ACHLI Heat-inducible transcription repressor hrcA OS=Acholeplasma laidlawii (strain PG-8A) GN=hrcA PE=3 SV=1 Length = 342 Score = 28.9 bits (63), Expect = 8.4 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -1 Query: 236 STRLPRGKGNLHAVQNMALRVGSPTDVLPLVDAIIEKR 123 S R+P +G + ++++ R T+V PL+D + K+ Sbjct: 62 SGRVPSERGYRYYIEHLVTRDNDVTEVFPLIDEVFSKK 99 >sp\|Q8L3A0\|HRCA_ACHLA Heat-inducible transcription repressor hrcA OS=Acholeplasma laidlawii GN=hrcA PE=3 SV=1 Length = 342 Score = 28.9 bits (63), Expect = 8.4 Identities = 11/38 (28%), Positives = 22/38 (57%) Frame = -1 Query: 236 STRLPRGKGNLHAVQNMALRVGSPTDVLPLVDAIIEKR 123 S R+P +G + ++++ R T+V PL+D + K+ Sbjct: 62 SGRVPSERGYRYYIEHLVTRDNDVTEVFPLIDEVFSKK 99
TrEMBL (release 39.9)	Link to BlastX Result : TrEMBL
tr_hit_id	A1WXU2
Definition	tr\|A1WXU2\|A1WXU2_HALHL Metal dependent phosphohydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1)
Align length	53
Score (bit)	32.7
E-value	9.1
Report	BLASTX 2.2.19 [Nov-02-2008] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= BP919804\|Adiantum capillus-veneris mRNA, clone: YMU001_000129_D02. (242 letters) Database: uniprot_trembl.fasta 7,341,751 sequences; 2,391,615,440 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value tr\|A1WXU2\|A1WXU2_HALHL Metal dependent phosphohydrolase OS=Halor... 33 9.1 >tr\|A1WXU2\|A1WXU2_HALHL Metal dependent phosphohydrolase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=Hhal_1740 PE=3 SV=1 Length = 736 Score = 32.7 bits (73), Expect = 9.1 Identities = 18/53 (33%), Positives = 29/53 (54%) Frame = -1 Query: 197 VQNMALRVGSPTDVLPLVDAIIEKRMQVQAYIDGEAQVCVMTKATMKETGVKA 39 ++++A R P + L + E+R +AYI+ QVC +A M E G+KA Sbjct: 203 LEDLAFRHLEPEAYMDLAKRLAERRRDREAYIE---QVCSQLQAAMDEAGLKA 252