BP919820
Clone id YMU001_000129_E07
Library
Length 516
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000129_E07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTTTTTGTTCAATCTTTCAACCTCTAGTATTGAGCGATCTCTATCTGAAAGAGTAG
CCGCAGCTTTGTTTTGGAAATACTGCACCTCTTTCTCTAGACCAGAACTCTTTTCAACCT
CTCTTTTCATTTGCTCTGCAAACTTGCTCTTAATAGAATAAACCTCCGACAATTCTTCTT
GCAACTTGACATTCTCCTTCTGGCATGCCTGCAGTTTCCTTTCACAAGCCTCTAGTTCTT
GCCCCAATTCATTTGACCTTCGGCCATGTATGCGAGTAACAAGATCCAGACCACTGAAAA
TACCACCCTGCAACGTAAAAGCCTGTTCTGTATTGCGGCGAAGCTCATCCCGCTCACGCT
CAAGCTGCACTATGCGACTGATTAGAGCGGCATTATCCATGGTGCCATGATCCATAACTC
GCATACCCATAGATAATGAAGACCTCAAACAAAGTACATGTCGAAACACTGCAGCTGGGC
AAAACACACTCTGATTTACAATGGAAGATAGCTATT
■■Homology search results ■■ -
sp_hit_id Q10411
Definition sp|Q10411|SPO15_SCHPO Sporulation-specific protein 15 OS=Schizosaccharomyces pombe
Align length 165
Score (bit) 45.8
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919820|Adiantum capillus-veneris mRNA, clone:
YMU001_000129_E07.
(503 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q10411|SPO15_SCHPO Sporulation-specific protein 15 OS=Schizos... 46 1e-04
sp|Q9M7J4|MFP1_TOBAC MAR-binding filament-like protein 1-1 OS=Ni... 42 0.002
sp|Q640L5|CCD18_MOUSE Coiled-coil domain-containing protein 18 O... 39 0.010
sp|O94964|CT117_HUMAN Uncharacterized protein C20orf117 OS=Homo ... 39 0.018
sp|A3KNA5|FIL1L_DANRE Filamin A-interacting protein 1-like OS=Da... 38 0.023
sp|A7E2Y1|MYH7B_HUMAN Myosin-7B OS=Homo sapiens GN=MYH7B PE=2 SV=2 37 0.052
sp|Q5K4R0|MAD47_ORYSJ MADS-box transcription factor 47 OS=Oryza ... 37 0.052
sp|Q6VGS5|DAPLE_MOUSE Protein Daple OS=Mus musculus GN=Ccdc88c P... 37 0.052
sp|Q9WVQ0|PMFBP_MOUSE Polyamine-modulated factor 1-binding prote... 37 0.068
sp|Q14789|GOGB1_HUMAN Golgin subfamily B member 1 OS=Homo sapien... 36 0.089
sp|A6NI86|GG6LA_HUMAN Putative golgin subfamily A member 6-like ... 36 0.089
sp|Q5TZA2|CROCC_HUMAN Rootletin OS=Homo sapiens GN=CROCC PE=1 SV=1 36 0.089
sp|P04460|MYH6_RABIT Myosin-6 (Fragment) OS=Oryctolagus cuniculu... 36 0.12
sp|Q9P219|DAPLE_HUMAN Protein Daple OS=Homo sapiens GN=CCDC88C P... 36 0.12
sp|Q5T9S5|CCD18_HUMAN Coiled-coil domain-containing protein 18 O... 36 0.12
sp|Q13439|GOGA4_HUMAN Golgin subfamily A member 4 OS=Homo sapien... 35 0.15
sp|Q8CJ40|CROCC_MOUSE Rootletin OS=Mus musculus GN=Crocc PE=1 SV=1 35 0.15
sp|P22312|PU92_SCICO Puff II/9-2 protein OS=Sciara coprophila GN... 35 0.20
sp|Q258K2|MYH9_CANFA Myosin-9 OS=Canis familiaris GN=MYH9 PE=2 SV=1 35 0.20
sp|A2AQP0|MYH7B_MOUSE Myosin-7B OS=Mus musculus GN=Myh7b PE=3 SV=1 35 0.20
sp|Q9QXL1|KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculu... 35 0.20
sp|O75037|KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapien... 35 0.20
sp|Q6IFX1|K1C24_RAT Keratin, type I cytoskeletal 24 OS=Rattus no... 35 0.20
sp|Q19020|DYHC_CAEEL Dynein heavy chain, cytoplasmic OS=Caenorha... 35 0.20
sp|P13496|DCTN1_DROME Dynactin subunit 1 OS=Drosophila melanogas... 35 0.20
sp|A4SF67|CNPD_PROVI 2',3'-cyclic-nucleotide 2'-phosphodiesteras... 35 0.20
sp|O42184|CLIP1_CHICK CAP-Gly domain-containing linker protein 1... 35 0.20
sp|Q0V9T6|CC64A_XENTR Coiled-coil domain-containing protein 64A ... 35 0.20
sp|P02564|MYH7_RAT Myosin-7 OS=Rattus norvegicus GN=Myh7 PE=2 SV=2 35 0.26
sp|Q8CEE0|CEP57_MOUSE Centrosomal protein of 57 kDa OS=Mus muscu... 35 0.26

>sp|Q10411|SPO15_SCHPO Sporulation-specific protein 15
OS=Schizosaccharomyces pombe GN=spo15 PE=1 SV=1
Length = 1957

Score = 45.8 bits (107), Expect = 1e-04
Identities = 41/165 (24%), Positives = 81/165 (49%), Gaps = 20/165 (12%)
Frame = -3

Query: 435 LRSSLSMGMRVMDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFS-------- 280
LRSSL++ + DN +++++ +L + D L + + Q L G+ S
Sbjct: 869 LRSSLNVAIS-------DNDQILTQLAELSKNYDSLEQESAQ---LNSGLKSLEAEKQLL 918

Query: 279 ---------GLDLVT---RIHGRRSNELGQELEACERKLQACQKENVKLQEELSEVYSIK 136
LD +T +I +S++LG++L A + ++ ++EN+ + ++ S+K
Sbjct: 919 HTENEELHIRLDKLTGKLKIEESKSSDLGKKLTARQEEISNLKEENMSQSQAIT---SVK 975

Query: 135 SKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSILEVERL 1
SK E + KSS LE ++++ +NK + +R+ + ERL
Sbjct: 976 SKLDETLS----KSSKLEADIEHLKNKVSEVEVERNALLASNERL 1016


>sp|Q9M7J4|MFP1_TOBAC MAR-binding filament-like protein 1-1
OS=Nicotiana tabacum GN=MFP1-1 PE=2 SV=1
Length = 722

Score = 41.6 bits (96), Expect = 0.002
Identities = 34/119 (28%), Positives = 57/119 (47%), Gaps = 1/119 (0%)
Frame = -3

Query: 357 VQLERERDELRRNTEQAFTLQGGIFSGLDLVT-RIHGRRSNELGQELEACERKLQACQKE 181
++LE R LRRN ++ T +G +L T R +++NE E+ +L A +
Sbjct: 471 MELEETRTSLRRNIDE--TKRGAELLAAELTTTRELLKKTNE---EMHTMSHELAAVTEN 525

Query: 180 NVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSILEVER 4
LQ EL +VY + A+++K+E LEKE+ + + + R E+ER
Sbjct: 526 CDNLQTELVDVYKKAERAADELKQEKNIVVTLEKELTFLEAQITREKESRKNLEEELER 584



Score = 31.6 bits (70), Expect = 2.2
Identities = 30/120 (25%), Positives = 51/120 (42%), Gaps = 10/120 (8%)
Frame = -3

Query: 354 QLERERD----ELRRNTEQAFTLQGGIFSGLDLVTRI------HGRRSNELGQELEACER 205
+L ERD +L+R E+ L + S VT + R + EL ++E +
Sbjct: 170 ELLNERDIRNNQLKRAGEERQALVNQLNSAKSTVTNLGQELQKEKRIAEELIVQIEGLQN 229

Query: 204 KLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDR 25
L +++ KLQEEL E + E++ + E +Q +K A S+ D+
Sbjct: 230 NLMQMKEDKKKLQEELKEKLDLIQVLQEKITLLTTEIKDKEASLQSTTSKLAEKESEVDK 289


>sp|Q640L5|CCD18_MOUSE Coiled-coil domain-containing protein 18
OS=Mus musculus GN=Ccdc18 PE=2 SV=1
Length = 1455

Score = 39.3 bits (90), Expect = 0.010
Identities = 36/121 (29%), Positives = 58/121 (47%), Gaps = 6/121 (4%)
Frame = -3

Query: 348 ERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENVKL 169
ER+R+E N E+ + L + ++ E E ER L C+KEN +L
Sbjct: 238 ERQRNEALYNAEE-------LSKAFQLYKEKVAEKLEKVQDEEEILERNLSNCEKENKRL 290

Query: 168 QEEL----SEVYSIKSKFAEQMKREVEKSSGLEK-EVQYFQN-KAAATLSDRDRSILEVE 7
QE+ SE+ +K KF E + E SG EK + +N + + L++ + IL++E
Sbjct: 291 QEKCNLYKSELEILKEKFRELKE---EHYSGKEKLMIMAMKNSEVMSQLTESRQCILKLE 347

Query: 6 R 4
R
Sbjct: 348 R 348


>sp|O94964|CT117_HUMAN Uncharacterized protein C20orf117 OS=Homo
sapiens GN=C20orf117 PE=1 SV=2
Length = 1423

Score = 38.5 bits (88), Expect = 0.018
Identities = 27/99 (27%), Positives = 46/99 (46%), Gaps = 1/99 (1%)
Frame = -3

Query: 387 MDNAALISRIVQLERERDELRR-NTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEAC 211
+D A+ RI+Q + E R Q + G + GL+ ++ S L +ELE
Sbjct: 23 LDQASKTCRILQYRLRKAERRSLRAAQTGQVDGELIRGLEQDVKVSKDISMRLHKELEVV 82

Query: 210 ERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKS 94
E+K ++EN +L++ L E K +++R E S
Sbjct: 83 EKKRARLEEENEELRQRLIETELAKQVLQTELERPREHS 121


>sp|A3KNA5|FIL1L_DANRE Filamin A-interacting protein 1-like OS=Danio
rerio GN=filip1l PE=2 SV=1
Length = 1129

Score = 38.1 bits (87), Expect = 0.023
Identities = 27/104 (25%), Positives = 51/104 (49%)
Frame = -3

Query: 366 SRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQ 187
+++ L +E + LRR ++ ++G + D + R SNE + +A +L+ +
Sbjct: 617 NKVKDLTQEVERLRRKLKEMKVVEGDLLKTEDEFESLEKRYSNE-QERAKALMEELETSR 675

Query: 186 KENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNK 55
KE K Q E + + +++K E KSS L +EV+ + K
Sbjct: 676 KELSKYQLAEKEESNQEQILYKRLKEEEAKSSHLTREVEALKEK 719


>sp|A7E2Y1|MYH7B_HUMAN Myosin-7B OS=Homo sapiens GN=MYH7B PE=2 SV=2
Length = 1941

Score = 37.0 bits (84), Expect = 0.052
Identities = 34/142 (23%), Positives = 59/142 (41%), Gaps = 10/142 (7%)
Frame = -3

Query: 402 MDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQE 223
++ T AAL + LER +E RR E+ + R S LG E
Sbjct: 1439 LERATSAAAALDKKQRHLERALEERRRQEEE-----------MQRELEAAQRESRGLGTE 1487

Query: 222 L-------EACERKLQACQKENVKLQEELSEV---YSIKSKFAEQMKREVEKSSGLEKEV 73
L E L+ ++EN LQEE+S++ S+ K +++++ + G + E+
Sbjct: 1488 LFRLRHGHEEALEALETLKRENKNLQEEISDLTDQVSLSGKSIQELEKTKKALEGEKSEI 1547

Query: 72 QYFQNKAAATLSDRDRSILEVE 7
Q +A L + L ++
Sbjct: 1548 QAALEEAEGALELEETKTLRIQ 1569


>sp|Q5K4R0|MAD47_ORYSJ MADS-box transcription factor 47 OS=Oryza
sativa subsp. japonica GN=MADS47 PE=1 SV=2
Length = 246

Score = 37.0 bits (84), Expect = 0.052
Identities = 27/102 (26%), Positives = 52/102 (50%), Gaps = 1/102 (0%)
Frame = -3

Query: 336 DELRR-NTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENVKLQEE 160
+EL R N EQ L+ + SGL V + +S ++ E++ ERK +EN++L+E+
Sbjct: 133 EELHRLNVEQLQELEKSLESGLGSVLKT---KSKKILDEIDGLERKRMQLIEENLRLKEQ 189

Query: 159 LSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSD 34
L +M R E G + E+ Y + +++ ++++
Sbjct: 190 LQ---------VSRMSRMEEMQPGPDSEIVYEEGQSSESVTN 222


>sp|Q6VGS5|DAPLE_MOUSE Protein Daple OS=Mus musculus GN=Ccdc88c PE=1
SV=1
Length = 2009

Score = 37.0 bits (84), Expect = 0.052
Identities = 32/116 (27%), Positives = 58/116 (50%)
Frame = -3

Query: 354 QLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENV 175
QLERE++ELRR+ E TL L+L + + +L LE+ K QA Q+E
Sbjct: 729 QLEREKEELRRDVELLKTLSKK-SERLELSYQSVSAENLQLQHSLESSTHKSQALQRELS 787

Query: 174 KLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSILEVE 7
+L+ E + + E ++ ++ G E++ + + + A ++D+ +LE E
Sbjct: 788 QLEAERQAL----RRDLETLQLTHKQLEGAEEDRKALEQEVAQL--EKDKKLLEKE 837



Score = 30.8 bits (68), Expect = 3.7
Identities = 30/110 (27%), Positives = 53/110 (48%)
Frame = -3

Query: 402 MDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQE 223
++ T + AL + QLE ER LRR+ E TLQ + L R++ L QE
Sbjct: 772 LESSTHKSQALQRELSQLEAERQALRRDLE---TLQ---LTHKQLEGAEEDRKA--LEQE 823

Query: 222 LEACERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEV 73
+ E+ + +KE +L +++ +I A ++ ++S L+KE+
Sbjct: 824 VAQLEKDKKLLEKEARRLWQQVELKDAILDDSAAKLSAAEKESRALDKEL 873


>sp|Q9WVQ0|PMFBP_MOUSE Polyamine-modulated factor 1-binding protein
1 OS=Mus musculus GN=Pmfbp1 PE=2 SV=1
Length = 1022

Score = 36.6 bits (83), Expect = 0.068
Identities = 18/66 (27%), Positives = 36/66 (54%)
Frame = -3

Query: 249 RRSNELGQELEACERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQ 70
++ +EL + E+K + KL+EEL E+ + + EQ+K+ E+ LE+E++
Sbjct: 595 KKIDELFHSTQVSEQKQRELTNSIRKLEEELLEIKGLLEEKREQLKKSKEQEKALEEEIE 654

Query: 69 YFQNKA 52
+ +A
Sbjct: 655 ALRQEA 660


>sp|Q14789|GOGB1_HUMAN Golgin subfamily B member 1 OS=Homo sapiens
GN=GOLGB1 PE=1 SV=2
Length = 3259

Score = 36.2 bits (82), Expect = 0.089
Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 9/126 (7%)
Frame = -3

Query: 351 LERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNE------LGQELEACERKLQAC 190
L RERD L +E AF++ + L + +++ + ++ L +LE ++Q+
Sbjct: 2777 LNRERDALL--SETAFSMNSTEENSLSHLEKLNQQLLSKDEQLLHLSSQLEDSYNQVQSF 2834

Query: 189 QKENVKLQEELSEVYSIKSKFA---EQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSI 19
K LQ E +++ KF E +R + S EVQ + ++ +DRDR +
Sbjct: 2835 SKAMASLQNERDHLWNELEKFRKSEEGKQRSAAQPSTSPAEVQSLKKAMSSLQNDRDRLL 2894

Query: 18 LEVERL 1
E++ L
Sbjct: 2895 KELKNL 2900



Score = 34.7 bits (78), Expect = 0.26
Identities = 27/92 (29%), Positives = 41/92 (44%), Gaps = 10/92 (10%)
Frame = -3

Query: 249 RRSNELGQELEA---CERKLQACQ-------KENVKLQEELSEVYSIKSKFAEQMKREVE 100
++ E+G+E A +RKLQA KEN LQEELS + + +
Sbjct: 1466 QKPEEIGEESRAKQQIQRKLQAALISRKEALKENKSLQEELSLARGTIERLTKSLADVES 1525

Query: 99 KSSGLEKEVQYFQNKAAATLSDRDRSILEVER 4
+ S KE + A +RD+ I E++R
Sbjct: 1526 QVSAQNKEKDTVLGRLALLQEERDKLITEMDR 1557



Score = 30.4 bits (67), Expect = 4.9
Identities = 16/76 (21%), Positives = 40/76 (52%)
Frame = -3

Query: 228 QELEACERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAA 49
+E++ E L ++EN+ L+EE + ++ E +K +++ + ++ F +
Sbjct: 2408 KEIKELENLLSQEEEENIVLEEENKKAVDKTNQLMETLKTIKKENIQQKAQLDSFVKSMS 2467

Query: 48 ATLSDRDRSILEVERL 1
+ +DRDR + + ++L
Sbjct: 2468 SLQNDRDRIVGDYQQL 2483


tr_hit_id A7QL83
Definition tr|A7QL83|A7QL83_VITVI Chromosome chr3 scaffold_117, whole genome shotgun sequence OS=Vitis vinifera
Align length 133
Score (bit) 103.0
E-value 6.0e-21
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919820|Adiantum capillus-veneris mRNA, clone:
YMU001_000129_E07.
(503 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QL83|A7QL83_VITVI Chromosome chr3 scaffold_117, whole genom... 103 6e-21
tr|Q9ZVK7|Q9ZVK7_ARATH Putative uncharacterized protein At2g1468... 102 8e-21
tr|A9RC64|A9RC64_PHYPA Predicted protein OS=Physcomitrella paten... 96 1e-18
tr|Q75KQ9|Q75KQ9_ORYSJ Expressed protein OS=Oryza sativa subsp. ... 87 6e-16
tr|B8AKF3|B8AKF3_ORYSI Putative uncharacterized protein OS=Oryza... 87 6e-16
tr|Q0DQZ5|Q0DQZ5_ORYSJ Os03g0431800 protein OS=Oryza sativa subs... 86 1e-15
tr|A5B597|A5B597_VITVI Putative uncharacterized protein OS=Vitis... 79 2e-13
tr|A3AJD3|A3AJD3_ORYSJ Putative uncharacterized protein OS=Oryza... 79 2e-13
tr|A0C117|A0C117_PARTE Chromosome undetermined scaffold_140, who... 46 0.001
tr|A0NCN0|A0NCN0_ANOGA AGAP000035-PA (Fragment) OS=Anopheles gam... 44 0.003
tr|B7FPH4|B7FPH4_PHATR Predicted protein OS=Phaeodactylum tricor... 43 0.007
tr|B2AUB0|B2AUB0_PODAN Predicted CDS Pa_1_18520 OS=Podospora ans... 43 0.010
tr|Q4Q8E1|Q4Q8E1_LEIMA Putative uncharacterized protein OS=Leish... 42 0.013
tr|Q52L24|Q52L24_XENLA LOC733209 protein (Fragment) OS=Xenopus l... 42 0.016
tr|A8DY79|A8DY79_DROME Bruchpilot, isoform C OS=Drosophila melan... 42 0.016
tr|A1Z7V1|A1Z7V1_DROME Bruchpilot, isoform H OS=Drosophila melan... 42 0.016
tr|Q8SWQ7|Q8SWQ7_LOLPE Non-muscle myosin II heavy chain OS=Lolig... 42 0.021
tr|Q16ZS4|Q16ZS4_AEDAE ApsB, putative OS=Aedes aegypti GN=AAEL00... 42 0.021
tr|B4KJW3|B4KJW3_DROMO GI17741 OS=Drosophila mojavensis GN=GI177... 42 0.021
tr|A0BVQ9|A0BVQ9_PARTE Chromosome undetermined scaffold_130, who... 42 0.021
tr|Q7QAJ3|Q7QAJ3_ANOGA AGAP003676-PA OS=Anopheles gambiae GN=AGA... 41 0.028
tr|B3MLF2|B3MLF2_DROAN GF15007 OS=Drosophila ananassae GN=GF1500... 41 0.028
tr|A6SD08|A6SD08_BOTFB Putative uncharacterized protein OS=Botry... 41 0.028
tr|A4VD15|A4VD15_TETTH DNA double-strand break repair rad50 ATPa... 41 0.037
tr|A6QLN6|A6QLN6_BOVIN MYH11 protein OS=Bos taurus GN=MYH11 PE=2... 40 0.048
tr|Q4SC51|Q4SC51_TETNG Chromosome 14 SCAF14660, whole genome sho... 40 0.062
tr|Q25B55|Q25B55_DROME CAST OS=Drosophila melanogaster GN=brp PE... 40 0.062
tr|A2QY10|A2QY10_ASPNC Function: the A. nidulans homolog aspB is... 40 0.062
tr|A2EC28|A2EC28_TRIVA Viral A-type inclusion protein, putative ... 40 0.081
tr|Q5V3F7|Q5V3F7_HALMA MCP domain signal transducer OS=Haloarcul... 40 0.081

>tr|A7QL83|A7QL83_VITVI Chromosome chr3 scaffold_117, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00001484001
PE=4 SV=1
Length = 658

Score = 103 bits (256), Expect = 6e-21
Identities = 60/133 (45%), Positives = 86/133 (64%)
Frame = -3

Query: 402 MDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQE 223
MD + DN +LI+RI QLE ERDELR++ EQ Q G S L + TR+H +R+ L QE
Sbjct: 1 MDEKSNDNESLIARIQQLEHERDELRKDIEQLCIQQAGP-SYLVVATRMHFQRTAGLEQE 59

Query: 222 LEACERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAAT 43
+E ++K+ A +EN+ LQEELSE Y IKS+ A+ E + EK++++FQ AA
Sbjct: 60 IENLKKKVAASTRENLNLQEELSEAYRIKSQLADLHNAE---NLDAEKQIKFFQGCVAAA 116

Query: 42 LSDRDRSILEVER 4
++RD SI+E E+
Sbjct: 117 FAERDHSIMEAEK 129


>tr|Q9ZVK7|Q9ZVK7_ARATH Putative uncharacterized protein At2g14680
OS=Arabidopsis thaliana GN=At2g14680 PE=4 SV=1
Length = 629

Score = 102 bits (255), Expect = 8e-21
Identities = 57/133 (42%), Positives = 85/133 (63%)
Frame = -3

Query: 402 MDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQE 223
MD +N L +RI QLE ER+EL+++ EQ QGG S L + R+H +R+ L QE
Sbjct: 1 MDLNLDENENLKARIKQLEHERNELQKDIEQLCMQQGGP-SILGVAARMHFQRTASLEQE 59

Query: 222 LEACERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAAT 43
+E+ + KL AC +E LQEEL+E Y +K++ A+ EV K+ EK+V++FQ AA
Sbjct: 60 IESLKLKLAACTREKHNLQEELAEAYRVKAQLADLHAGEVAKNLEAEKQVRFFQGSVAAA 119

Query: 42 LSDRDRSILEVER 4
S+RD+S++E E+
Sbjct: 120 FSERDKSVMEAEK 132


>tr|A9RC64|A9RC64_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_64414 PE=4 SV=1
Length = 933

Score = 95.9 bits (237), Expect = 1e-18
Identities = 57/158 (36%), Positives = 88/158 (55%), Gaps = 31/158 (19%)
Frame = -3

Query: 381 NAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERK 202
NAAL+ RIVQLE+ERDEL+++ E Q G+ +D+ TR+ RR+ L QELE + K
Sbjct: 7 NAALMRRIVQLEKERDELQKDIETICLQQSGVAGSIDVNTRMQARRAANLEQELETYKEK 66

Query: 201 LQACQKENVKLQEELSEVYSIK---------------------------SKFAEQMKREV 103
+EN LQ+ELSE Y +K ++ E KR V
Sbjct: 67 TSLLTRENHGLQQELSEAYRLKYYLIIGTAAYDLQREFDCDFPQYLMLQTQITEAFKRAV 126

Query: 102 EK----SSGLEKEVQYFQNKAAATLSDRDRSILEVERL 1
EK ++ +EK+V+++Q+K A ++RD++++EVER+
Sbjct: 127 EKAFFQNNQVEKDVKFYQSKVATAFAERDKALVEVERV 164


>tr|Q75KQ9|Q75KQ9_ORYSJ Expressed protein OS=Oryza sativa subsp.
japonica GN=OSJNBa0036E17.12 PE=4 SV=1
Length = 677

Score = 86.7 bits (213), Expect = 6e-16
Identities = 45/113 (39%), Positives = 71/113 (62%)
Frame = -3

Query: 342 ERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENVKLQE 163
ERDELR++ EQ Q + + TR+ +R+ L Q++E ++KL C +EN LQE
Sbjct: 56 ERDELRKDIEQLCMQQQAGPGYVSVATRMLSQRTAALEQDIENLQKKLGGCLRENQNLQE 115

Query: 162 ELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSILEVER 4
EL+E Y IKS+ AE E+ K+ LEK+V++FQ+ A ++RD S+++ E+
Sbjct: 116 ELAEAYRIKSQLAELHGAELSKNKELEKQVRFFQSSVAQAFAERDNSLMKCEK 168


>tr|B8AKF3|B8AKF3_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_12160 PE=4 SV=1
Length = 677

Score = 86.7 bits (213), Expect = 6e-16
Identities = 45/113 (39%), Positives = 71/113 (62%)
Frame = -3

Query: 342 ERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENVKLQE 163
ERDELR++ EQ Q + + TR+ +R+ L Q++E ++KL C +EN LQE
Sbjct: 56 ERDELRKDIEQLCMQQQAGPGYVSVATRMLSQRTAALEQDIENLQKKLGGCLRENQNLQE 115

Query: 162 ELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSILEVER 4
EL+E Y IKS+ AE E+ K+ LEK+V++FQ+ A ++RD S+++ E+
Sbjct: 116 ELAEAYRIKSQLAELHGAELSKNKELEKQVRFFQSSVAQAFAERDNSLMKCEK 168


>tr|Q0DQZ5|Q0DQZ5_ORYSJ Os03g0431800 protein OS=Oryza sativa subsp.
japonica GN=Os03g0431800 PE=4 SV=1
Length = 879

Score = 85.5 bits (210), Expect = 1e-15
Identities = 44/113 (38%), Positives = 71/113 (62%)
Frame = -3

Query: 342 ERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENVKLQE 163
+RDELR++ EQ Q + + TR+ +R+ L Q++E ++KL C +EN LQE
Sbjct: 314 QRDELRKDIEQLCMQQQAGPGYVSVATRMLSQRTAALEQDIENLQKKLGGCLRENQNLQE 373

Query: 162 ELSEVYSIKSKFAEQMKREVEKSSGLEKEVQYFQNKAAATLSDRDRSILEVER 4
EL+E Y IKS+ AE E+ K+ LEK+V++FQ+ A ++RD S+++ E+
Sbjct: 374 ELAEAYRIKSQLAELHGAELSKNKELEKQVRFFQSSVAQAFAERDNSLMKCEK 426


>tr|A5B597|A5B597_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_013872 PE=4 SV=1
Length = 108

Score = 78.6 bits (192), Expect = 2e-13
Identities = 47/101 (46%), Positives = 65/101 (64%)
Frame = -3

Query: 402 MDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQE 223
MD + DN +LI+RI QLE ERDELR++ EQ Q G S L + TR+H +R+ L QE
Sbjct: 1 MDEKSNDNESLIARIQQLEHERDELRKDIEQLCIQQAGP-SYLVVATRMHFQRTAGLEQE 59

Query: 222 LEACERKLQACQKENVKLQEELSEVYSIKSKFAEQMKREVE 100
+E ++K+ A +EN+ LQEELSE Y IK KR+++
Sbjct: 60 IENLKKKVAASTRENLNLQEELSEAYRIKVFGKGVAKRDLD 100


>tr|A3AJD3|A3AJD3_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_010905 PE=4 SV=1
Length = 687

Score = 78.6 bits (192), Expect = 2e-13
Identities = 45/123 (36%), Positives = 71/123 (57%), Gaps = 10/123 (8%)
Frame = -3

Query: 342 ERDELRRNTEQAFTLQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQACQKENVKLQE 163
ERDELR++ EQ Q + + TR+ +R+ L Q++E ++KL C +EN LQE
Sbjct: 56 ERDELRKDIEQLCMQQQAGPGYVSVATRMLSQRTAALEQDIENLQKKLGGCLRENQNLQE 115

Query: 162 ELSEVYSIKSKFAEQMKREVEK----------SSGLEKEVQYFQNKAAATLSDRDRSILE 13
EL+E Y IKS+ AE E+ K + LEK+V++FQ+ A ++RD S+++
Sbjct: 116 ELAEAYRIKSQLAELHGAELSKVTFFLETIMQNKELEKQVRFFQSSVAQAFAERDNSLMK 175

Query: 12 VER 4
E+
Sbjct: 176 CEK 178


>tr|A0C117|A0C117_PARTE Chromosome undetermined scaffold_140, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00033960001 PE=4 SV=1
Length = 704

Score = 45.8 bits (107), Expect = 0.001
Identities = 30/140 (21%), Positives = 66/140 (47%), Gaps = 13/140 (9%)
Frame = -3

Query: 435 LRSSLSMGMRVMDHGTMDNAALISRIVQLERER---DELRRNTEQAFTLQGGIFSGLDLV 265
L + M +++D + N L+ ++ +L+ E+ D+L + ++ + I L+
Sbjct: 381 LEKQIDMNKKLLDEQVVTNRQLMEKLFKLQTEKQQNDQLLKQVQEELKYRNQIIVDLENN 440

Query: 264 TRIHGRRSNELGQELEACERKLQACQKENVKLQEELSEVYSIKSKF----------AEQM 115
++ NE+ Q LE ++ + QKEN +E + + I+SK+ EQ+
Sbjct: 441 SQKDNIILNEMNQNLEKAVQQNKELQKENFNYKESIDQCKKIESKYYDLLQQNNNQLEQL 500

Query: 114 KREVEKSSGLEKEVQYFQNK 55
+ V+++ L+K Q + +
Sbjct: 501 NQVVKENGALQKIQQQIEGE 520


>tr|A0NCN0|A0NCN0_ANOGA AGAP000035-PA (Fragment) OS=Anopheles gambiae
GN=AGAP000035 PE=4 SV=2
Length = 2123

Score = 44.3 bits (103), Expect = 0.003
Identities = 37/147 (25%), Positives = 62/147 (42%), Gaps = 3/147 (2%)
Frame = -3

Query: 435 LRSSLSMGMRVMDHGTMDNAALISRIVQLERERDELRRNTEQAFTLQGGIFSGLDLVTRI 256
L++SL + T + A L + LER+ E R N +L G + LDL+ +
Sbjct: 1652 LQTSLDEQRAQCEEQTRELAQLRDTVASLERQTHEDRTNISILTSLNGALNEDLDLLQQQ 1711

Query: 255 HGRRSNELGQELEACERKLQACQKENVKLQ---EELSEVYSIKSKFAEQMKREVEKSSGL 85
G L+ CE+K +A Q LQ E + Y S EQ R +E +
Sbjct: 1712 TGEAEQRYQTLLDQCEQKQRALQTVEADLQRQTEAADQRYEQLSGEFEQKCRALEAAEQT 1771

Query: 84 EKEVQYFQNKAAATLSDRDRSILEVER 4
+ + + ++ L ++R E++R
Sbjct: 1772 LAQEMARKEQLSSALDTKERECAELQR 1798



Score = 33.5 bits (75), Expect = 5.8
Identities = 24/101 (23%), Positives = 53/101 (52%), Gaps = 2/101 (1%)
Frame = -3

Query: 366 SRIVQLERERDELRRNTEQAFT--LQGGIFSGLDLVTRIHGRRSNELGQELEACERKLQA 193
+R Q+ER + ELR + + T L+ + + + ++G+ EL + +E + +L
Sbjct: 1067 ARTQQIERLQAELRHSVAETATEELEAELQHKQETIDTLNGQII-ELYRTVEEHQERLDG 1125

Query: 192 CQKENVKLQEELSEVYSIKSKFAEQMKREVEKSSGLEKEVQ 70
Q E ++++ E+ KFA +K++ + + LE+E++
Sbjct: 1126 AQAERRLVEQKNEELLEKLKKFAANLKKKNVQCAELERELE 1166