BP919836
Clone id YMU001_000129_F11
Library
Length 526
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000129_F11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTGGAGATGATACTGCACATCCTATTATGTAAATGTGCAAAGGCTGAAAACAATGCAAAG
TCGAGAACTTGTAACATGTTTGCCCATGTTTAAGGTTGCTGATATGCAAAAGGTTTGTGA
AGCATGTCAATTTGGAAAGCAATCAAGAGGTCCATTTCCAAAAGACAAGCATGTAAGCAG
CAATGTGCTAGAGTTGGTACACTCAGATGTATGGGGTCTAGCAAAGACTGCGTCTATGGG
TGGATACAGGTTTTATGTTACCTTTACTGATGACCATACTCGCAAAGTATGGGTGTATTT
CATGAAGGAGAAGAGTGAGGTGTATACTCACTTTCGGAATTTCAAGGCTATGGCTGAAAA
ACAGACAGGGAAACATGTATAGTGCCTGAGGTCAGATGGAGGGGGAGAATACTTCTCCAA
TGAGCTTAATAGTTTTTTGAAAAAGCATGGAATTTAGAGGCAATTTTCATGCAGGTATAC
TCCACAGTAAAAATGGTGTTGCTGAGCGAAAGAACATGCGAGTACC
■■Homology search results ■■ -
sp_hit_id P10978
Definition sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from transposon TNT 1-94 OS=Nicotiana tabacum
Align length 126
Score (bit) 115.0
E-value 1.0e-25
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919836|Adiantum capillus-veneris mRNA, clone:
YMU001_000129_F11.
(526 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from tra... 115 1e-25
sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster G... 80 5e-15
sp|O13527|YA11B_YEAST Transposon Ty1-A Gag-Pol polyprotein OS=Sa... 53 1e-06
sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein OS=... 52 1e-06
sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein OS=S... 52 1e-06
sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein OS=S... 52 1e-06
sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q04214|YM13B_YEAST Transposon Ty1-MR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q03434|YM12B_YEAST Transposon Ty1-ML2 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q04711|YM11B_YEAST Transposon Ty1-ML1 Gag-Pol polyprotein OS=... 52 1e-06
sp|P0C2I6|YL13B_YEAST Transposon Ty1-LR3 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12088|YL11B_YEAST Transposon Ty1-LR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|P47100|YJ12B_YEAST Transposon Ty1-JR2 Gag-Pol polyprotein OS=... 52 1e-06
sp|P47098|YJ11B_YEAST Transposon Ty1-JR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|O13535|YH11B_YEAST Transposon Ty1-H Gag-Pol polyprotein OS=Sa... 52 1e-06
sp|Q12316|YG13B_YEAST Transposon Ty1-GR3 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12141|YG11B_YEAST Transposon Ty1-GR1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q03619|YE12B_YEAST Transposon Ty1-ER2 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q03612|YE11B_YEAST Transposon Ty1-ER1 Gag-Pol polyprotein OS=... 52 1e-06
sp|Q12193|YB12B_YEAST Transposon Ty1-BR Gag-Pol polyprotein OS=S... 52 1e-06
sp|Q12490|YB11B_YEAST Transposon Ty1-BL Gag-Pol polyprotein OS=S... 52 1e-06
sp|Q12414|YP11B_YEAST Transposon Ty1-PL Gag-Pol polyprotein OS=S... 52 2e-06
sp|P0C2I7|YL14B_YEAST Transposon Ty1-LR4 Gag-Pol polyprotein OS=... 52 2e-06
sp|P0C2I5|YL12B_YEAST Transposon Ty1-LR2 Gag-Pol polyprotein OS=... 52 2e-06
sp|Q12269|YG12B_YEAST Transposon Ty1-GR2 Gag-Pol polyprotein OS=... 52 2e-06
sp|P0C2I3|YD15B_YEAST Transposon Ty1-DR6 Gag-Pol polyprotein OS=... 52 2e-06
sp|P0C2I2|YD14B_YEAST Transposon Ty1-DR5 Gag-Pol polyprotein OS=... 52 2e-06

>sp|P10978|POLX_TOBAC Retrovirus-related Pol polyprotein from
transposon TNT 1-94 OS=Nicotiana tabacum PE=2 SV=1
Length = 1328

Score = 115 bits (289), Expect = 1e-25
Identities = 56/126 (44%), Positives = 78/126 (61%)
Frame = +2

Query: 110 KVCEACQFGKQSRGPFPKDKHVSSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTRKV 289
K C+ C FGKQ R F N+L+LV+SDV G + SMGG +++VTF DD +RK+
Sbjct: 455 KPCDYCLFGKQHRVSFQTSSERKLNILDLVYSDVCGPMEIESMGGNKYFVTFIDDASRKL 514

Query: 290 WVYFMKEKSEVYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI*RQFS 469
WVY +K K +V+ F+ F A+ E++TG+ + LRSD GGEY S E + HGI + +
Sbjct: 515 WVYILKTKDQVFQVFQKFHALVERETGRKLKRLRSDNGGEYTSREFEEYCSSHGIRHEKT 574

Query: 470 CRYTPQ 487
TPQ
Sbjct: 575 VPGTPQ 580


>sp|P04146|COPIA_DROME Copia protein OS=Drosophila melanogaster
GN=GIP PE=1 SV=3
Length = 1409

Score = 80.5 bits (197), Expect = 5e-15
Identities = 48/128 (37%), Positives = 66/128 (51%), Gaps = 2/128 (1%)
Frame = +2

Query: 110 KVCEACQFGKQSRGPFP--KDKHVSSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
++CE C GKQ+R PF KDK L +VHSDV G ++ ++V F D T
Sbjct: 453 EICEPCLNGKQARLPFKQLKDKTHIKRPLFVVHSDVCGPITPVTLDDKNYFVIFVDQFTH 512

Query: 284 KVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI*RQ 463
Y +K KS+V++ F++F A +E V L D G EY SNE+ F K GI
Sbjct: 513 YCVTYLIKYKSDVFSMFQDFVAKSEAHFNLKVVYLYIDNGREYLSNEMRQFCVKKGISYH 572

Query: 464 FSCRYTPQ 487
+ +TPQ
Sbjct: 573 LTVPHTPQ 580


>sp|O13527|YA11B_YEAST Transposon Ty1-A Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-A PE=1 SV=2
Length = 1755

Score = 52.8 bits (125), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 LRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|P0C2J1|YP14B_YEAST Transposon Ty1-PR3 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-PR3 PE=2 SV=1
Length = 1755

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|P0C2I9|YP12B_YEAST Transposon Ty1-PR1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-PR1 PE=3 SV=1
Length = 1755

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|Q92393|YO12B_YEAST Transposon Ty1-OR Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-OR PE=1 SV=1
Length = 1755

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|Q12273|YO11B_YEAST Transposon Ty1-OL Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-OL PE=3 SV=1
Length = 1755

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|Q99337|YN12B_YEAST Transposon Ty1-NL2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-NL2 PE=1 SV=1
Length = 1749

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|Q12112|YN11B_YEAST Transposon Ty1-NL1 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-NL1 PE=3 SV=1
Length = 1755

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


>sp|Q04670|YM14B_YEAST Transposon Ty1-MR2 Gag-Pol polyprotein
OS=Saccharomyces cerevisiae GN=TY1B-MR2 PE=1 SV=2
Length = 1755

Score = 52.4 bits (124), Expect = 1e-06
Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 6/119 (5%)
Frame = +2

Query: 116 CEACQFGKQSRGPFPKDKHV----SSNVLELVHSDVWGLAKTASMGGYRFYVTFTDDHTR 283
C C GK ++ K + S + +H+D++G ++++FTD+ T+
Sbjct: 637 CPDCLIGKSTKHRHIKGSRLKYQNSYEPFQYLHTDIFGPVHNLPKSAPSYFISFTDETTK 696

Query: 284 KVWVYFMKEKSE--VYTHFRNFKAMAEKQTGKHV*CLRSDGGGEYFSNELNSFLKKHGI 454
WVY + ++ E + F A + Q V ++ D G EY + L+ FL+K+GI
Sbjct: 697 FRWVYPLHDRREDSILDVFTTILAFIKNQFQASVLVIQMDRGSEYTNRTLHKFLEKNGI 755


tr_hit_id A5BFG0
Definition tr|A5BFG0|A5BFG0_VITVI Putative uncharacterized protein OS=Vitis vinifera
Align length 155
Score (bit) 144.0
E-value 4.0e-33
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919836|Adiantum capillus-veneris mRNA, clone:
YMU001_000129_F11.
(526 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5BFG0|A5BFG0_VITVI Putative uncharacterized protein OS=Vitis... 144 4e-33
tr|A5AL21|A5AL21_VITVI Putative uncharacterized protein OS=Vitis... 141 2e-32
tr|A5AWP3|A5AWP3_VITVI Putative uncharacterized protein OS=Vitis... 140 3e-32
tr|A5BT67|A5BT67_VITVI Putative uncharacterized protein OS=Vitis... 139 7e-32
tr|A5AHH2|A5AHH2_VITVI Putative uncharacterized protein OS=Vitis... 138 2e-31
tr|A5B902|A5B902_VITVI Putative uncharacterized protein OS=Vitis... 137 4e-31
tr|A5ALW9|A5ALW9_VITVI Putative uncharacterized protein OS=Vitis... 137 4e-31
tr|Q9LPK1|Q9LPK1_ARATH F6N18.1 OS=Arabidopsis thaliana PE=4 SV=2 136 7e-31
tr|Q9FH39|Q9FH39_ARATH Copia-type polyprotein (Polyprotein) OS=A... 136 7e-31
tr|Q9C7Y1|Q9C7Y1_ARATH Copia-type polyprotein, putative; 28768-3... 136 7e-31
tr|Q9LH44|Q9LH44_ARATH Copia-like retrotransposable element OS=A... 135 2e-30
tr|A5B557|A5B557_VITVI Putative uncharacterized protein OS=Vitis... 134 4e-30
tr|Q6L3N8|Q6L3N8_SOLDE Putative gag-pol polyprotein, identical O... 133 6e-30
tr|Q9SHL9|Q9SHL9_ARATH Putative retroelement pol polyprotein OS=... 132 1e-29
tr|A5BPC1|A5BPC1_VITVI Putative uncharacterized protein OS=Vitis... 130 3e-29
tr|Q9AY59|Q9AY59_ORYSJ Putative copia-like retrotransposon Hopsc... 129 7e-29
tr|Q7G7H3|Q7G7H3_ORYSA Putative gag-pol protein OS=Oryza sativa ... 129 7e-29
tr|A5BE52|A5BE52_VITVI Putative uncharacterized protein OS=Vitis... 129 9e-29
tr|Q9M1C6|Q9M1C6_ARATH Putative uncharacterized protein T2O9.150... 128 1e-28
tr|B4MVS9|B4MVS9_DROWI GK15001 OS=Drosophila willistoni GN=GK150... 127 3e-28
tr|A5BIJ3|A5BIJ3_VITVI Putative uncharacterized protein OS=Vitis... 127 3e-28
tr|B6REL8|B6REL8_9BRAS Integrase OS=Boechera divaricarpa GN=TnIn... 126 4e-28
tr|B8LKX7|B8LKX7_PICSI Putative uncharacterized protein OS=Picea... 126 8e-28
tr|Q6L3Y5|Q6L3Y5_SOLDE Gag-pol polyprotein, putative OS=Solanum ... 125 1e-27
tr|B8YLY7|B8YLY7_LOTJA Gag-Pol polyprotein OS=Lotus japonicus PE... 125 2e-27
tr|A5BFU1|A5BFU1_VITVI Putative uncharacterized protein OS=Vitis... 124 2e-27
tr|Q0E1G5|Q0E1G5_ORYSJ Os02g0450400 protein OS=Oryza sativa subs... 124 4e-27
tr|A5BHI5|A5BHI5_VITVI Putative uncharacterized protein OS=Vitis... 124 4e-27
tr|B6V6Z8|B6V6Z8_DROME Polyprotein OS=Drosophila melanogaster PE... 124 4e-27
tr|B8YLY5|B8YLY5_MEDTR Gag-Pol polyprotein OS=Medicago truncatul... 123 5e-27

>tr|A5BFG0|A5BFG0_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_017285 PE=4 SV=1
Length = 672

Score = 144 bits (362), Expect = 4e-33
Identities = 72/155 (46%), Positives = 99/155 (63%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDK-HVSSNVLELVH 202
++N LKT+Q + +VT LP + +VCE C GKQ R FP+ K + NVLELVH
Sbjct: 324 HLNFGGLKTLQQKHMVTGLPQISIPS--QVCEECVVGKQHRSQFPQGKSRRAKNVLELVH 381

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
SD+ GL S GG ++ + F DD++RK WV F++EKSE ++ F++FKA EK+TG+ +
Sbjct: 382 SDICGLINPTSNGGKKYLIIFIDDYSRKTWVSFLQEKSEAFSAFKSFKARVEKETGRSIK 441

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
LR+D GGEY SNE F GI R+ + YTPQ
Sbjct: 442 ILRTDRGGEYCSNEFEHFCDDQGIRRELTAAYTPQ 476


>tr|A5AL21|A5AL21_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_031870 PE=4 SV=1
Length = 1274

Score = 141 bits (355), Expect(2) = 2e-32
Identities = 67/155 (43%), Positives = 104/155 (67%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDK-HVSSNVLELVH 202
++NV+ LK + +E+V LP D VCE C +GKQS+ PFPK + +S+ LE++H
Sbjct: 446 HLNVKGLKLLSKKEMVFGLPKI---DSVNVCEGCIYGKQSKKPFPKGRSRRASSCLEIIH 502

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G +TAS GG R+++ FTDDH+R WVYF++ K+E + F+ FKA EKQ+GK +
Sbjct: 503 ADLCGPMQTASFGGSRYFLLFTDDHSRMSWVYFLQSKAETFETFKKFKAFVEKQSGKCIK 562

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
LR+D GGE+ SN+ F ++ G+ R+ + Y+P+
Sbjct: 563 VLRTDRGGEFLSNDFKVFCEEEGLHRELTTPYSPE 597



Score = 21.6 bits (44), Expect(2) = 2e-32
Identities = 9/12 (75%), Positives = 10/12 (83%)
Frame = +3

Query: 489 KNGVAERKNMRV 524
+NGVAERKN V
Sbjct: 598 QNGVAERKNRTV 609


>tr|A5AWP3|A5AWP3_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_020777 PE=4 SV=1
Length = 1472

Score = 140 bits (353), Expect(2) = 3e-32
Identities = 67/154 (43%), Positives = 103/154 (66%), Gaps = 1/154 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDK-HVSSNVLELVH 202
++NV+ LK + +E+V LP D VCE C +GKQS+ PFPK + +S+ LE++H
Sbjct: 431 HLNVKGLKLLSKKEMVFGLPKI---DSVNVCEGCIYGKQSKKPFPKGRSRRASSCLEIIH 487

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G +TAS GG R+++ FTDDH+R WVYF++ K+E + F+ FKA EKQ+GK +
Sbjct: 488 ADLCGPMQTASFGGSRYFLLFTDDHSRMSWVYFLQSKAETFETFKKFKAFVEKQSGKCIK 547

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTP 484
LR+D GGE+ SN+ F ++ G+ R+ + Y+P
Sbjct: 548 VLRTDRGGEFLSNDFKVFXEEEGLHRELTTPYSP 581



Score = 21.6 bits (44), Expect(2) = 3e-32
Identities = 9/12 (75%), Positives = 10/12 (83%)
Frame = +3

Query: 489 KNGVAERKNMRV 524
+NGVAERKN V
Sbjct: 583 QNGVAERKNRTV 594


>tr|A5BT67|A5BT67_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_020406 PE=4 SV=1
Length = 1183

Score = 139 bits (350), Expect(2) = 7e-32
Identities = 66/155 (42%), Positives = 104/155 (67%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDK-HVSSNVLELVH 202
++NV+ LK + +E+V LP D VCE C +GKQS+ PFPK + +S+ LE++H
Sbjct: 380 HLNVKGLKLLSKKEMVFGLPKI---DSVNVCEGCIYGKQSKKPFPKGRSRRASSCLEIIH 436

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G +TAS GG R+++ FT+DH+R WVYF++ K+E + F+ FKA EKQ+GK +
Sbjct: 437 ADLCGPMQTASFGGSRYFLLFTNDHSRMSWVYFLQSKAETFETFKKFKAFVEKQSGKCIK 496

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
LR+D GGE+ SN+ F ++ G+ R+ + Y+P+
Sbjct: 497 VLRTDRGGEFLSNDFKVFCEEEGLHRELTTPYSPE 531



Score = 21.6 bits (44), Expect(2) = 7e-32
Identities = 9/12 (75%), Positives = 10/12 (83%)
Frame = +3

Query: 489 KNGVAERKNMRV 524
+NGVAERKN V
Sbjct: 532 QNGVAERKNRTV 543


>tr|A5AHH2|A5AHH2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032906 PE=4 SV=1
Length = 1430

Score = 138 bits (347), Expect(2) = 2e-31
Identities = 66/155 (42%), Positives = 103/155 (66%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDK-HVSSNVLELVH 202
++NV+ LK + +E+V LP D VCE C +GKQS+ PFPK + +S+ LE++H
Sbjct: 557 HLNVKGLKLLSKKEMVFELPKI---DSVNVCEGCIYGKQSKKPFPKGRSRRASSCLEIIH 613

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G +TAS GG R+++ FTDDH+R WVYF++ K+E + F+ FKA EKQ+GK +
Sbjct: 614 ADLCGPMQTASFGGSRYFLLFTDDHSRMSWVYFLQSKAETFETFKKFKAFVEKQSGKCIK 673

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
LR+D GE+ SN+ F ++ G+ R+ + Y+P+
Sbjct: 674 VLRTDRXGEFLSNDFKVFCEEEGLHRELTTPYSPE 708



Score = 21.6 bits (44), Expect(2) = 2e-31
Identities = 9/12 (75%), Positives = 10/12 (83%)
Frame = +3

Query: 489 KNGVAERKNMRV 524
+NGVAERKN V
Sbjct: 709 QNGVAERKNRTV 720


>tr|A5B902|A5B902_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_032980 PE=4 SV=1
Length = 1283

Score = 137 bits (344), Expect = 4e-31
Identities = 69/155 (44%), Positives = 97/155 (62%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDKHVSSN-VLELVH 202
++N LKT+Q + +VT LP + ++CE C GKQ R FPK K N VLELVH
Sbjct: 432 HLNFGGLKTLQQKNMVTGLP--PIXTPSQICEECVVGKQHRYQFPKGKSWRXNKVLELVH 489

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
SD+ G S GG R+++TF D++ K WVYF++EKSE ++ F++FK + EK+ K +
Sbjct: 490 SDICGPINPTSNGGKRYFITFIXDYSXKTWVYFLQEKSEAFSTFKSFKMLVEKEAXKPIK 549

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
RSD GGEY S E +F + HGI +Q + Y+PQ
Sbjct: 550 IFRSDXGGEYTSQEFVNFCENHGIQKQLTAAYSPQ 584


>tr|A5ALW9|A5ALW9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_042489 PE=4 SV=1
Length = 1246

Score = 137 bits (344), Expect = 4e-31
Identities = 69/155 (44%), Positives = 97/155 (62%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDKHVSSN-VLELVH 202
++N LKT+Q + +VT LP + ++CE C GKQ R FPK K N VLELVH
Sbjct: 432 HLNFXXLKTLQXKNMVTGLPXIQTXS--QICEECVXGKQHRYQFPKGKSWRXNKVLELVH 489

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
SD+ G S GG R+++TF D++ K WVYF++EKSE ++ F++FK + EK+ K +
Sbjct: 490 SDICGPINPTSNGGKRYFITFIXDYSWKTWVYFLQEKSEAFSTFKSFKMLVEKEAXKPIK 549

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
RSD GGEY S E +F + HGI +Q + Y+PQ
Sbjct: 550 IFRSDXGGEYTSQEFVNFCENHGIQKQLTAAYSPQ 584


>tr|Q9LPK1|Q9LPK1_ARATH F6N18.1 OS=Arabidopsis thaliana PE=4 SV=2
Length = 1207

Score = 136 bits (342), Expect = 7e-31
Identities = 67/155 (43%), Positives = 97/155 (62%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDKH-VSSNVLELVH 202
++N Q L+++ +E+V LP F + + + VC+ C GKQ R PK+ S+ VL+LVH
Sbjct: 346 HLNHQGLRSLAEKEMVKGLPKFDLGEEEAVCDICLKGKQIRESIPKESAWKSTQVLQLVH 405

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G AS G R+ + F DD +RK W Y + EKSE + F+ FKA E+++GK +
Sbjct: 406 TDICGPINPASTSGKRYILNFIDDFSRKCWTYLLSEKSETFQFFKEFKAEVERESGKKLV 465

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
CLRSD GGEY S E + + K+ GI RQ + YTPQ
Sbjct: 466 CLRSDRGGEYNSREFDEYCKEFGIKRQLTAAYTPQ 500


>tr|Q9FH39|Q9FH39_ARATH Copia-type polyprotein (Polyprotein)
OS=Arabidopsis thaliana PE=4 SV=1
Length = 1334

Score = 136 bits (342), Expect = 7e-31
Identities = 67/155 (43%), Positives = 97/155 (62%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDKH-VSSNVLELVH 202
++N Q L+++ +E+V LP F + + + VC+ C GKQ R PK+ S+ VL+LVH
Sbjct: 441 HLNHQGLRSLAEKEMVKGLPKFDLGEEEAVCDICLKGKQIRESIPKESAWKSTQVLQLVH 500

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G AS G R+ + F DD +RK W Y + EKSE + F+ FKA E+++GK +
Sbjct: 501 TDICGPINPASTSGKRYILNFIDDFSRKCWTYLLSEKSETFQFFKEFKAEVERESGKKLV 560

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
CLRSD GGEY S E + + K+ GI RQ + YTPQ
Sbjct: 561 CLRSDRGGEYNSREFDEYCKEFGIKRQLTAAYTPQ 595


>tr|Q9C7Y1|Q9C7Y1_ARATH Copia-type polyprotein, putative;
28768-32772 OS=Arabidopsis thaliana GN=T9G5.7 PE=4 SV=1
Length = 1334

Score = 136 bits (342), Expect = 7e-31
Identities = 67/155 (43%), Positives = 97/155 (62%), Gaps = 1/155 (0%)
Frame = +2

Query: 26 YVNVQRLKTMQSRELVTCLPMFKVADMQKVCEACQFGKQSRGPFPKDKH-VSSNVLELVH 202
++N Q L+++ +E+V LP F + + + VC+ C GKQ R PK+ S+ VL+LVH
Sbjct: 441 HLNHQGLRSLAEKEMVKGLPKFDLGEEEAVCDICLKGKQIRESIPKESAWKSTQVLQLVH 500

Query: 203 SDVWGLAKTASMGGYRFYVTFTDDHTRKVWVYFMKEKSEVYTHFRNFKAMAEKQTGKHV* 382
+D+ G AS G R+ + F DD +RK W Y + EKSE + F+ FKA E+++GK +
Sbjct: 501 TDICGPINPASTSGKRYILNFIDDFSRKCWTYLLSEKSETFQFFKEFKAEVERESGKKLV 560

Query: 383 CLRSDGGGEYFSNELNSFLKKHGI*RQFSCRYTPQ 487
CLRSD GGEY S E + + K+ GI RQ + YTPQ
Sbjct: 561 CLRSDRGGEYNSREFDEYCKEFGIKRQLTAAYTPQ 595