BP919868
Clone id YMU001_000130_B02
Library
Length 470
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000130_B02.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
TTTTTTTGTTTTTTTCTGCAATAATCTTGTGTATTGCATGAGATACACAAGGGCTTCTAG
AGACAACCCACAAGCCAAGTATCTACAACGCTCAATTGACGAGTGTGATGGTGGTCGTAA
TTGGCTCATGTCGAAGCCTCAGAATATGCCTCGACAATGCATCAAGCCCAACCCTTTGTA
TGGCCACCTCAATGTGATGAATTCCAACATAATTCAAAAAGCGTGACTTGTCTCATCATG
ACTGCTGAAGGACAAGTTTACCGCACACACCCCTTGTACACTTTAACCAATATATGATTG
AAAAACTAAAGAATGTTAAGAATCTTTTGCCTCAGAGCTTGTCAAAATTACCTCTAAGAA
CCCATAGTACAGGTCTTGTATCGCTAGTGTGTCGGTCCGGAAGGTTCACCTTATTTAAAG
GCAGTGACCAACTTTGGTTTATGGATGTCACGGACGAAACCACTCTTTAG
■■Homology search results ■■ -
sp_hit_id P91887
Definition sp|P91887|AMPN_PLUXY Aminopeptidase N OS=Plutella xylostella
Align length 35
Score (bit) 30.8
E-value 3.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919868|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_B02.
(470 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P91887|AMPN_PLUXY Aminopeptidase N OS=Plutella xylostella GN=... 31 3.1
sp|Q6CUU2|TOF1_KLULA Topoisomerase 1-associated factor 1 OS=Kluy... 30 6.9
sp|A7ZRV0|MUG_ECO24 G/U mismatch-specific DNA glycosylase OS=Esc... 30 6.9

>sp|P91887|AMPN_PLUXY Aminopeptidase N OS=Plutella xylostella
GN=APN1 PE=1 SV=1
Length = 946

Score = 30.8 bits (68), Expect = 3.1
Identities = 13/35 (37%), Positives = 20/35 (57%)
Frame = -2

Query: 463 VVSSVTSINQSWSLPLNKVNLPDRHTSDTRPVLWV 359
+ S N W++PLN V D + +DTRP+ W+
Sbjct: 524 LTDSTQESNTVWNVPLNWVLSTDVNFNDTRPMAWL 558


>sp|Q6CUU2|TOF1_KLULA Topoisomerase 1-associated factor 1
OS=Kluyveromyces lactis GN=TOF1 PE=3 SV=1
Length = 1162

Score = 29.6 bits (65), Expect = 6.9
Identities = 21/84 (25%), Positives = 36/84 (42%), Gaps = 4/84 (4%)
Frame = +3

Query: 228 LSHHDC*RTSLPHTPLVHFNQYMIEKLKNVKNLLPQSLSKLPLRTHSTGLVSLVCRSGRF 407
LS TS T FN+Y +++LKN +P + +S R G+
Sbjct: 726 LSQQGLPTTSELRTHFTKFNEYYLKQLKNKLKKMPSLYINILFPMLHDSQISYYMRHGKM 785

Query: 408 TLFKGSDQL----WFMDVTDETTL 467
L +G+ + F+++ DE +L
Sbjct: 786 KLTEGTPDIVLPSTFINIPDEGSL 809


>sp|A7ZRV0|MUG_ECO24 G/U mismatch-specific DNA glycosylase
OS=Escherichia coli O139:H28 (strain E24377A / ETEC)
GN=mug PE=3 SV=1
Length = 168

Score = 29.6 bits (65), Expect = 6.9
Identities = 21/80 (26%), Positives = 36/80 (45%), Gaps = 8/80 (10%)
Frame = +3

Query: 228 LSHHDC*RTSLPHTPLVHFNQYMIEKL--------KNVKNLLPQSLSKLPLRTHSTGLVS 383
L + C T L P V N+ ++L + +++ PQ+L+ L R + G
Sbjct: 59 LLDYRCGVTKLVDRPTVQANEVSKQELHAGGRKLIEKIEDYQPQALAILGKRAYEQGFSQ 118

Query: 384 LVCRSGRFTLFKGSDQLWFM 443
+ G+ TL GS Q+W +
Sbjct: 119 RGAQWGKQTLTIGSTQIWVL 138


tr_hit_id A5E3I1
Definition tr|A5E3I1|A5E3I1_LODEL Sulfate permease 1 OS=Lodderomyces elongisporus
Align length 30
Score (bit) 37.0
E-value 0.5
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919868|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_B02.
(470 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A5E3I1|A5E3I1_LODEL Sulfate permease 1 OS=Lodderomyces elongi... 37 0.50

>tr|A5E3I1|A5E3I1_LODEL Sulfate permease 1 OS=Lodderomyces
elongisporus GN=LELG_04168 PE=3 SV=1
Length = 824

Score = 37.0 bits (84), Expect = 0.50
Identities = 16/30 (53%), Positives = 23/30 (76%), Gaps = 1/30 (3%)
Frame = -2

Query: 430 WSLP-LNKVNLPDRHTSDTRPVLWVLRGNF 344
W+LP L K N+P++H SDTRPVL ++ +F
Sbjct: 695 WNLPFLRKYNVPEKHESDTRPVLRIVHFDF 724