BP919891
Clone id YMU001_000130_D03
Library
Length 493
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000130_D03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
AACTGGATCCACTACACAAATTTGAGGGTGGCTACTGAGATGCCGTAGTGCTCGTTGCAT
TGCATCTGTAAATATGACCTGATCCTGCATCTGGCCTTGTGCTCCAAAAGCAACACTTGC
TATTTCATCTGTAGGTTTATGAAGCATAATATCAAGTATCTCAAACTGCTTACACATTGA
CACCTCCACATTGACGGGGAGAAAGCAGAGATTCTTGTTGGTTATGTGGATTGGGAGGGC
ACCCCGCTTTAAAAAATCCAGCTCTCTGCTCCATTTCATCGAGTATCCAGCAATGATGAC
TTCGTCACCTACGTCCTGCTTGCTTATATGAGCGATCTGACAATAAAGTTCTTGAATAAG
ACAGATTGTCTTGTCACTTAGCCCTTCTAAATCCGTAGAGTCTGAAGGTAGGCAGATGTG
CCAGCCTTGACTGACCAAGTTGCTTTTTACAGGAGCTTCCAACAAAGGTGTCAAAAATAC
ACATTCCGAAACA
■■Homology search results ■■ -
sp_hit_id O80568
Definition sp|O80568|ITPK4_ARATH Inositol-tetrakisphosphate 1-kinase 4 OS=Arabidopsis thaliana
Align length 137
Score (bit) 78.6
E-value 1.0e-14
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919891|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_D03.
(493 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O80568|ITPK4_ARATH Inositol-tetrakisphosphate 1-kinase 4 OS=A... 79 1e-14
sp|Q54XT8|U399_DICDI UPF0399 protein OS=Dictyostelium discoideum... 31 2.7
sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protei... 30 4.6
sp|O74424|NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces ... 30 6.0
sp|A8H2Z3|MNMC_SHEPA tRNA 5-methylaminomethyl-2-thiouridine bios... 30 7.9

>sp|O80568|ITPK4_ARATH Inositol-tetrakisphosphate 1-kinase 4
OS=Arabidopsis thaliana GN=ITPK4 PE=2 SV=2
Length = 488

Score = 78.6 bits (192), Expect = 1e-14
Identities = 50/137 (36%), Positives = 73/137 (53%), Gaps = 6/137 (4%)
Frame = -2

Query: 393 DLEG--LSDKTICLI---QELYCQIAHISKQDVGDEVIIAGYSMKWSRELDFLKRGALPI 229
D+EG L D I I +EL I I+K+ +GD I Y MK SR DF KRGALP+
Sbjct: 118 DVEGDSLEDPNIIHIHSLEELPMTICCINKKAMGDGAAIVAYIMKPSRVEDFAKRGALPM 177

Query: 228 HITNKNLCFLPVNVEVSMCKQFEILDIMLHKPTDEIASVAFG-AQGQMQDQVIFTDAMQR 52
+ T+ L FLP+ E + Q + DI+ HK TDEI S+ + + V F+ M++
Sbjct: 178 YPTSCGLIFLPLMFEFPLASQLKHADIIFHKATDEILSIELNCSDSKSSVAVTFSTGMEK 237

Query: 51 ALRHLSSHPQICVVDPV 1
+++ +VDP+
Sbjct: 238 LKKYMEDQNACAIVDPI 254


>sp|Q54XT8|U399_DICDI UPF0399 protein OS=Dictyostelium discoideum
GN=DDB_G0278751 PE=3 SV=1
Length = 298

Score = 31.2 bits (69), Expect = 2.7
Identities = 15/53 (28%), Positives = 25/53 (47%)
Frame = -2

Query: 273 WSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKPTDEIAS 115
WS E++ +K+G P HI+NK + + + K LD + I+S
Sbjct: 229 WSNEIESVKKGKTPYHISNKTVKQFELQEKFKQLKASNKLDKFMETKRKRISS 281


>sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protein
At1g31920 OS=Arabidopsis thaliana GN=PCMP-H11 PE=2 SV=1
Length = 606

Score = 30.4 bits (67), Expect = 4.6
Identities = 19/67 (28%), Positives = 31/67 (46%)
Frame = -2

Query: 207 CFLPVNVEVSMCKQFEILDIMLHKPTDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSH 28
C + N+E+ E+L + H P D + +QGQM D V T + A++ L
Sbjct: 413 CRVRQNIELGQIAAQELLKLSSHNPGDYLLISNLYSQGQMWDDVART-RTEIAIKGLKQT 471

Query: 27 PQICVVD 7
P +V+
Sbjct: 472 PGFSIVE 478


>sp|O74424|NU211_SCHPO Nucleoporin nup211 OS=Schizosaccharomyces
pombe GN=nup211 PE=1 SV=1
Length = 1837

Score = 30.0 bits (66), Expect = 6.0
Identities = 27/91 (29%), Positives = 44/91 (48%), Gaps = 3/91 (3%)
Frame = -2

Query: 399 STDLEGLSDKTICLIQELYCQIAHISKQDVGDEVIIAGYSMKWSRELDFLKR--GALPIH 226
S +L+G++DK + L QE + + +S Q + D V+ E D L+R +L
Sbjct: 210 SRELQGVNDKLLSLHQEASLEKSQLSSQ-LSDAVL----------EKDALQRKVSSLSQQ 258

Query: 225 ITNKNLCFLPVNVEVS-MCKQFEILDIMLHK 136
T NL + + E+S M KQ+E + K
Sbjct: 259 FTESNLRYQNIVAELSEMRKQYEFSQVSFEK 289


>sp|A8H2Z3|MNMC_SHEPA tRNA 5-methylaminomethyl-2-thiouridine
biosynthesis bifunctional protein mnmC OS=Shewanella
pealeana (strain ATCC 700345 / ANG-SQ1) GN=mnmC PE=3
SV=1
Length = 641

Score = 29.6 bits (65), Expect = 7.9
Identities = 17/55 (30%), Positives = 26/55 (47%)
Frame = -2

Query: 477 FLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQD 313
+LT L P+ ++ GWH+ +D T L Q L+ Q+A +SK D
Sbjct: 105 YLTQLQALPMVNDGFVDGWHVTSDADQTQLR----------QILFWQLAKLSKND 149


tr_hit_id B8A0H7
Definition tr|B8A0H7|B8A0H7_MAIZE Putative uncharacterized protein OS=Zea mays
Align length 163
Score (bit) 98.6
E-value 1.0e-19
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919891|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_D03.
(493 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8A0H7|B8A0H7_MAIZE Putative uncharacterized protein OS=Zea m... 99 1e-19
tr|B4FNB3|B4FNB3_MAIZE Putative uncharacterized protein OS=Zea m... 99 1e-19
tr|B4FBE5|B4FBE5_MAIZE Putative uncharacterized protein OS=Zea m... 99 1e-19
tr|A7QB12|A7QB12_VITVI Chromosome chr5 scaffold_72, whole genome... 95 2e-18
tr|Q69IU4|Q69IU4_ORYSJ Putative inositol 1,3,4-trisphosphate 5/6... 94 5e-18
tr|Q0J0B2|Q0J0B2_ORYSJ Os09g0518700 protein OS=Oryza sativa subs... 94 5e-18
tr|B8BDK0|B8BDK0_ORYSI Putative uncharacterized protein OS=Oryza... 94 5e-18
tr|A9TU72|A9TU72_PHYPA Predicted protein (Fragment) OS=Physcomit... 90 7e-17
tr|B6TYJ7|B6TYJ7_MAIZE Inositol 1, 3, 4-trisphosphate 5/6-kinase... 89 1e-16
tr|A5ALN1|A5ALN1_VITVI Putative uncharacterized protein OS=Vitis... 79 9e-14
tr|A8JH59|A8JH59_CHLRE Predicted protein (Fragment) OS=Chlamydom... 40 0.078
tr|Q83V33|Q83V33_PSEFL 2-aminomuconate 6-semialdehyde dehydrogen... 34 4.3
tr|Q9SQ49|Q9SQ49_9ROSI Vicilin (Fragment) OS=Rulingia madagascar... 33 5.6
tr|A8Q6I3|A8Q6I3_MALGO Putative uncharacterized protein OS=Malas... 33 7.3
tr|Q7M866|Q7M866_WOLSU ALDEHYDE FERREDOXIN OXIDOREDUCTASE OS=Wol... 33 9.5
tr|Q6LFH9|Q6LFH9_PLAF7 Chaperone, putative OS=Plasmodium falcipa... 33 9.5

>tr|B8A0H7|B8A0H7_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 412

Score = 98.6 bits (244), Expect = 1e-19
Identities = 51/163 (31%), Positives = 88/163 (53%), Gaps = 1/163 (0%)
Frame = -2

Query: 489 SECVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDV 310
S C + T ++ + S L +Q W + ++ +E + +QEL +A + K+++
Sbjct: 8 SFCFYATSRVDKGLISELQNQNWRVLSVANECSIEVPGVLNVQRLQELLLTLATLMKKEL 67

Query: 309 -GDEVIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKP 133
G V++ GY MK SRE DF KRGA PI+ + +L F+P++ E+ + Q + +D++LHK
Sbjct: 68 CGSSVLVIGYIMKKSREEDFAKRGAFPIYPSKGSLIFVPLSFEIPLSLQLQEVDMVLHKI 127

Query: 132 TDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
TDEI + + F+ M +R + HP C++DP
Sbjct: 128 TDEIVKIDPNCSIDFPKGISFSAGMSEIIRFVEEHPDFCIMDP 170


>tr|B4FNB3|B4FNB3_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 478

Score = 98.6 bits (244), Expect = 1e-19
Identities = 51/163 (31%), Positives = 88/163 (53%), Gaps = 1/163 (0%)
Frame = -2

Query: 489 SECVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDV 310
S C + T ++ + S L +Q W + ++ +E + +QEL +A + K+++
Sbjct: 74 SFCFYATSRVDKGLISELQNQNWRVLSVANECSIEVPGVLNVQRLQELLLTLATLMKKEL 133

Query: 309 -GDEVIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKP 133
G V++ GY MK SRE DF KRGA PI+ + +L F+P++ E+ + Q + +D++LHK
Sbjct: 134 CGSSVLVIGYIMKKSREEDFAKRGAFPIYPSKGSLIFVPLSFEIPLSLQLQEVDMVLHKI 193

Query: 132 TDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
TDEI + + F+ M +R + HP C++DP
Sbjct: 194 TDEIVKIDPNCSIDFPKGISFSAGMSEIIRFVEEHPDFCIMDP 236


>tr|B4FBE5|B4FBE5_MAIZE Putative uncharacterized protein OS=Zea mays
PE=2 SV=1
Length = 502

Score = 98.6 bits (244), Expect = 1e-19
Identities = 51/163 (31%), Positives = 88/163 (53%), Gaps = 1/163 (0%)
Frame = -2

Query: 489 SECVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDV 310
S C + T ++ + S L +Q W + ++ +E + +QEL +A + K+++
Sbjct: 98 SFCFYATSRVDKGLISELQNQNWRVLSVANECSIEVPGVLNVQRLQELLLTLATLMKKEL 157

Query: 309 -GDEVIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKP 133
G V++ GY MK SRE DF KRGA PI+ + +L F+P++ E+ + Q + +D++LHK
Sbjct: 158 CGSSVLVIGYIMKKSREEDFAKRGAFPIYPSKGSLIFVPLSFEIPLSLQLQEVDMVLHKI 217

Query: 132 TDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
TDEI + + F+ M +R + HP C++DP
Sbjct: 218 TDEIVKIDPNCSIDFPKGISFSAGMSEIIRFVEEHPDFCIMDP 260


>tr|A7QB12|A7QB12_VITVI Chromosome chr5 scaffold_72, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034761001
PE=4 SV=1
Length = 499

Score = 94.7 bits (234), Expect = 2e-18
Identities = 40/118 (33%), Positives = 72/118 (61%)
Frame = -2

Query: 357 IQELYCQIAHISKQDVGDEVIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVS 178
++EL I ++K+D+ ++V+ GY MK SRE DF KRGA P++ + L F+P+ +
Sbjct: 135 LEELPLTICRLNKKDISNDVVTVGYIMKPSREEDFSKRGAFPMYPSQNGLIFMPLTFALP 194

Query: 177 MCKQFEILDIMLHKPTDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
+ Q + +D++LHK TDEI S+ + ++ +++ +T M ++ HP C++DP
Sbjct: 195 ISSQLQEVDVVLHKATDEIMSIKLNSSSELSNRITYTRGMLELGMYMEHHPDFCLIDP 252


>tr|Q69IU4|Q69IU4_ORYSJ Putative inositol 1,3,4-trisphosphate
5/6-kinase OS=Oryza sativa subsp. japonica GN=P0498F03.7
PE=4 SV=1
Length = 504

Score = 93.6 bits (231), Expect = 5e-18
Identities = 48/161 (29%), Positives = 85/161 (52%), Gaps = 1/161 (0%)
Frame = -2

Query: 483 CVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDVGD 304
C ++T + + S L + W + + ++ I ++QEL +A K+++G+
Sbjct: 104 CFYVTSGVHEGLLSELQNHNWEVIAMGNEDVIKNSGVIHISMLQELLITLATSIKKEIGN 163

Query: 303 E-VIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKPTD 127
+ GY MK SRE DF KRGA PI+ + +L F+P++ E+ + Q + +D++LHK TD
Sbjct: 164 SSAFVVGYVMKQSREEDFAKRGAFPIYPSKNDLIFVPLSFELPLASQLQEVDLVLHKITD 223

Query: 126 EIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
EI ++ + + F+ M +R + H CV+DP
Sbjct: 224 EIINIDPNSSISFPKGISFSPGMSEIIRFVEEHCDFCVIDP 264


>tr|Q0J0B2|Q0J0B2_ORYSJ Os09g0518700 protein OS=Oryza sativa subsp.
japonica GN=Os09g0518700 PE=2 SV=1
Length = 547

Score = 93.6 bits (231), Expect = 5e-18
Identities = 48/161 (29%), Positives = 85/161 (52%), Gaps = 1/161 (0%)
Frame = -2

Query: 483 CVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDVGD 304
C ++T + + S L + W + + ++ I ++QEL +A K+++G+
Sbjct: 147 CFYVTSGVHEGLLSELQNHNWEVIAMGNEDVIKNSGVIHISMLQELLITLATSIKKEIGN 206

Query: 303 E-VIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKPTD 127
+ GY MK SRE DF KRGA PI+ + +L F+P++ E+ + Q + +D++LHK TD
Sbjct: 207 SSAFVVGYVMKQSREEDFAKRGAFPIYPSKNDLIFVPLSFELPLASQLQEVDLVLHKITD 266

Query: 126 EIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
EI ++ + + F+ M +R + H CV+DP
Sbjct: 267 EIINIDPNSSISFPKGISFSPGMSEIIRFVEEHCDFCVIDP 307


>tr|B8BDK0|B8BDK0_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_32064 PE=4 SV=1
Length = 547

Score = 93.6 bits (231), Expect = 5e-18
Identities = 48/161 (29%), Positives = 85/161 (52%), Gaps = 1/161 (0%)
Frame = -2

Query: 483 CVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDVGD 304
C ++T + + S L + W + + ++ I ++QEL +A K+++G+
Sbjct: 147 CFYVTSGVHEGLLSELQNHNWEVIAMGNEDVIKNSGVIHISMLQELLITLATSIKKEIGN 206

Query: 303 E-VIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKPTD 127
+ GY MK SRE DF KRGA PI+ + +L F+P++ E+ + Q + +D++LHK TD
Sbjct: 207 SSAFVVGYVMKQSREEDFAKRGAFPIYPSKNDLIFVPLSFELPLASQLQEVDLVLHKITD 266

Query: 126 EIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
EI ++ + + F+ M +R + H CV+DP
Sbjct: 267 EIINIDPNSSISFPKGISFSPGMSEIIRFVEEHCDFCVIDP 307


>tr|A9TU72|A9TU72_PHYPA Predicted protein (Fragment)
OS=Physcomitrella patens subsp. patens
GN=PHYPADRAFT_150853 PE=4 SV=1
Length = 350

Score = 89.7 bits (221), Expect = 7e-17
Identities = 42/109 (38%), Positives = 69/109 (63%)
Frame = -2

Query: 327 ISKQDVGDEVIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDI 148
+++Q G E+++ G+ MKWSRE DFLKR LP T+ +L F+P+ + M Q + +DI
Sbjct: 1 VAEQAFGVELLVVGHVMKWSREKDFLKRRMLPSVPTSNDLVFVPLRTDRPMETQLDAVDI 60

Query: 147 MLHKPTDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDPV 1
+LHK TDEI SV +++ ++D+++ R++ HP C+VDP+
Sbjct: 61 ILHKATDEIVSVTTIQTPNPAERIQYSDSIKTLQRYIEEHPGKCIVDPI 109


>tr|B6TYJ7|B6TYJ7_MAIZE Inositol 1, 3, 4-trisphosphate 5/6-kinase
family protein OS=Zea mays PE=2 SV=1
Length = 502

Score = 89.0 bits (219), Expect = 1e-16
Identities = 48/163 (29%), Positives = 86/163 (52%), Gaps = 1/163 (0%)
Frame = -2

Query: 489 SECVFLTPLLEAPVKSNLVSQGWHICLPSDSTDLEGLSDKTICLIQELYCQIAHISKQDV 310
S C + T ++ + S L +Q W + ++ +E + +Q+L +A + K+++
Sbjct: 98 SFCFYATSRVDKGLISELQNQNWRVLSVANECSIEVPGVLNVQRLQQLLLTLATLIKREL 157

Query: 309 GDE-VIIAGYSMKWSRELDFLKRGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKP 133
D V++ GY MK SRE DF +RGA PI+ + +L F+P++ E+ + Q + +D+ LHK
Sbjct: 158 CDSSVLVIGYIMKKSREEDFARRGAFPIYPSKGSLIFVPLSFELPLSLQLQEVDMALHKI 217

Query: 132 TDEIASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
TDEI + + F+ M +R + HP ++DP
Sbjct: 218 TDEIVKIDPNCSIDFPKGISFSTGMSEIIRFVEEHPDFRIMDP 260


>tr|A5ALN1|A5ALN1_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_004636 PE=4 SV=1
Length = 1511

Score = 79.3 bits (194), Expect = 9e-14
Identities = 44/159 (27%), Positives = 78/159 (49%), Gaps = 25/159 (15%)
Frame = -2

Query: 405 SDSTDLEGLSDKTICLIQELYCQIAHIS------KQDVGDEVIIAGYSMKWSRELDFLK- 247
S++TD +G + +I L +I I +D+ ++V+ GY MK SRE DF K
Sbjct: 224 SEATDKDGTEGPGLMVIWYLMREIKDIFLEFVFVAEDISNDVVTVGYIMKPSREEDFSKV 283

Query: 246 ------------------RGALPIHITNKNLCFLPVNVEVSMCKQFEILDIMLHKPTDEI 121
RGA P++ + L F+P+ + + Q + +D++LHK TDEI
Sbjct: 284 RLYIEKKAVSALEKELSTRGAFPMYPSQNGLIFMPLTFALPISSQLQEVDVVLHKATDEI 343

Query: 120 ASVAFGAQGQMQDQVIFTDAMQRALRHLSSHPQICVVDP 4
S+ + ++ +++ +T M ++ HP C++DP
Sbjct: 344 MSIKLNSSSELSNRITYTRGMLELGMYMEHHPDFCLIDP 382