BP919897
Clone id YMU001_000130_D11
Library
Length 535
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000130_D11.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CCCTCTGGTAAAGTCAAAATTTTTGTTTCGGTCTTTGTTAGGTCATTTAGACATCATACG
CGTATGATGTCTAAAGTTGCAGATTTTCAGTTTTTTGGCACAGAATCCTTCCTAAAGCTT
TCTCAAGTGCTCGGCAACTCCCAGATACACAGAAAATTTCTCTGACTTTTGTTTATTGCA
AGTTTCACTACTAACTGGACGGTTTAGTGATCTAACATGCAATCAACCATATCAAGCAAA
TACTCCAATGATTACTAGCTCTAGATCAGGATCAAATGAAGTCCTACCTAAGCTATTCCT
AATCATAAAATGGGTTTGGTAATTGTGATTTTAAAGAGATCCACTGCCACTCACGGACTT
AGCAAATTCCTCTTCTATCAACAACTACTCAACACCAACAAAACAACAAACAAATCTAAG
CTAAGCTAAAAATACTGTCAACACGGAAGACCCAGGAATACCCCACTTCCTAGTATCTCT
CGAGATCTTCGGAGTCCACCACTCCTAGATCTTTTCTAACTAAAGTATACAAAGT
■■Homology search results ■■ -
sp_hit_id Q96WS6
Definition sp|Q96WS6|MEU15_SCHPO Meiotic expression up-regulated protein 15 OS=Schizosaccharomyces pombe
Align length 31
Score (bit) 30.0
E-value 7.4
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919897|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_D11.
(535 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q96WS6|MEU15_SCHPO Meiotic expression up-regulated protein 15... 30 7.4

>sp|Q96WS6|MEU15_SCHPO Meiotic expression up-regulated protein 15
OS=Schizosaccharomyces pombe GN=meu15 PE=2 SV=1
Length = 150

Score = 30.0 bits (66), Expect = 7.4
Identities = 12/31 (38%), Positives = 18/31 (58%)
Frame = -1

Query: 484 LERY*EVGYSWVFRVDSIFSLA*ICLLFCWC 392
LE Y EV Y W+F ++ ++ + L CWC
Sbjct: 63 LEHY-EVPYKWIFIIEMLYYELYLTLYVCWC 92


tr_hit_id -
Definition No hits.
Align length -
Score (bit) -
E-value -
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919897|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_D11.
(535 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done

***** No hits found ******