BP919910
Clone id YMU001_000130_F01
Library
Length 447
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000130_F01.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
TTTTTTGTATGTATCCATTAGCCAATTGTAATTTTATTCGAGTTTGTCTAATGGCTGGTT
TTCCCCATGATTCCCATACTGCTTTTGTGGCTATGGCTATGCCACCTTCACTGTCCAGTA
TTGCCATGTTTTCTAAATCATTATATCTCACCAAAAGGGTTGTGTTTCCTTATTCCCCTT
TGTAGTATTCTCCAAATTTGCTCATTGGGACGGATCTAATCTCCTTGTTATCCAATTTGT
GTTTCAATTATCCCAATTTTTTTGAGATTAGCCCTATTATACCCACTTTCTCTAGAGTTT
TTTGTAAATCATTCCATAAATATGGTCTAACTTTTACATTTCTCCCAAGGTAAGAGTGCA
CTGAGTGGGTGTAGACATGATTGAATGGATGTTGTCTACCTTTAGGACCTATTCCACTCT
TTTTACCTGAGTGGTTTTACACACTAT
■■Homology search results ■■ -
sp_hit_id O00086
Definition sp|O00086|IMDH3_CANAL Probable inosine-5'-monophosphate dehydrogenase OS=Candida albicans
Align length 44
Score (bit) 32.3
E-value 0.93
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919910|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_F01.
(447 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O00086|IMDH3_CANAL Probable inosine-5'-monophosphate dehydrog... 32 0.93
sp|Q8NHU2|CT026_HUMAN Uncharacterized protein C20orf26 OS=Homo s... 29 7.8

>sp|O00086|IMDH3_CANAL Probable inosine-5'-monophosphate
dehydrogenase OS=Candida albicans GN=IMH3 PE=1 SV=1
Length = 521

Score = 32.3 bits (72), Expect = 0.93
Identities = 18/44 (40%), Positives = 25/44 (56%)
Frame = -3

Query: 346 GRNVKVRPYLWNDLQKTLEKVGIIGLISKKLG*LKHKLDNKEIR 215
G K PYL+N LQ +L+ +GI K + L+ +DN EIR
Sbjct: 457 GSITKFVPYLYNGLQHSLQDIGI-----KSIDELRENVDNGEIR 495


>sp|Q8NHU2|CT026_HUMAN Uncharacterized protein C20orf26 OS=Homo
sapiens GN=C20orf26 PE=2 SV=3
Length = 1237

Score = 29.3 bits (64), Expect = 7.8
Identities = 18/43 (41%), Positives = 23/43 (53%)
Frame = -3

Query: 406 PKGRQHPFNHVYTHSVHSYLGRNVKVRPYLWNDLQKTLEKVGI 278
PK R+ F + Y HS+ S L V VRP + LEK+GI
Sbjct: 593 PKSREGKFQNPYAHSLTSALHYLVPVRPR--RQIVYPLEKLGI 633


tr_hit_id B5Y2Z4
Definition tr|B5Y2Z4|B5Y2Z4_KLEP3 Putative uncharacterized protein OS=Klebsiella pneumoniae (strain 342)
Align length 61
Score (bit) 33.5
E-value 5.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919910|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_F01.
(447 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B5Y2Z4|B5Y2Z4_KLEP3 Putative uncharacterized protein OS=Klebs... 33 5.3
tr|Q6CWA8|Q6CWA8_KLULA KLLA0B05511p OS=Kluyveromyces lactis GN=K... 33 5.3
tr|A6CXE8|A6CXE8_9VIBR Elongation factor G OS=Vibrio shilonii AK... 33 7.0
tr|A5DX10|A5DX10_LODEL Inosine-5'-monophosphate dehydrogenase IM... 33 7.0
tr|A3J785|A3J785_9FLAO Putative uncharacterized protein (Fragmen... 33 9.1

>tr|B5Y2Z4|B5Y2Z4_KLEP3 Putative uncharacterized protein
OS=Klebsiella pneumoniae (strain 342) GN=KPK_5061 PE=4
SV=1
Length = 185

Score = 33.5 bits (75), Expect = 5.3
Identities = 17/61 (27%), Positives = 27/61 (44%)
Frame = +3

Query: 24 NCNFIRVCLMAGFPHDSHTAFVAMAMPPSLSSIAMFSKSLYLTKRVVFPYSPL*YSPNLL 203
N N I AGFPHD + + ++ MF +S + + +FP+S N L
Sbjct: 77 NANLIEAIKAAGFPHDRYQTTTIVNTDDAIPGTGMFVRSSIESNKKLFPWSQFIVDSNGL 136

Query: 204 I 206
+
Sbjct: 137 V 137


>tr|Q6CWA8|Q6CWA8_KLULA KLLA0B05511p OS=Kluyveromyces lactis
GN=KLLA0B05511g PE=4 SV=1
Length = 523

Score = 33.5 bits (75), Expect = 5.3
Identities = 16/40 (40%), Positives = 24/40 (60%)
Frame = -3

Query: 334 KVRPYLWNDLQKTLEKVGIIGLISKKLG*LKHKLDNKEIR 215
K PYL+N LQ + + +G+I L L+ K+DN E+R
Sbjct: 463 KYIPYLYNGLQHSCQDIGVISLTE-----LREKVDNSEVR 497


>tr|A6CXE8|A6CXE8_9VIBR Elongation factor G OS=Vibrio shilonii AK1
GN=VSAK1_03279 PE=4 SV=1
Length = 671

Score = 33.1 bits (74), Expect = 7.0
Identities = 40/133 (30%), Positives = 61/133 (45%), Gaps = 5/133 (3%)
Frame = -3

Query: 430 SGKKSGIGPKGRQHPFNHVYTHSVHSYLGRNVKVRPYLWNDLQKTLEKVGIIGLISK--K 257
+GK+ I R H HVY +V Y+G+ VR + + T +G SK K
Sbjct: 272 NGKRVSIDCDKRDHTVAHVYKINVDPYMGKLAYVRVF---QGELTTGSQLFVGDSSKAFK 328

Query: 256 LG*LKHKLDNKEIRSVPMSKFGEYYKGE*GNTTLLVRYNDLE-NMAILDS--EGGIAIAT 86
+G L + L K+ + + +K G+ +LV+ +DLE + I DS E G+A T
Sbjct: 329 VGHL-YNLQGKKRQEISSAKAGD--------LCVLVKVDDLEFDSVIHDSHDEDGVAFKT 379

Query: 85 KAVWESWGKPAIR 47
ES A+R
Sbjct: 380 LNFPESMYSLALR 392


>tr|A5DX10|A5DX10_LODEL Inosine-5'-monophosphate dehydrogenase IMD2
OS=Lodderomyces elongisporus GN=LELG_01897 PE=4 SV=1
Length = 521

Score = 33.1 bits (74), Expect = 7.0
Identities = 18/44 (40%), Positives = 26/44 (59%)
Frame = -3

Query: 346 GRNVKVRPYLWNDLQKTLEKVGIIGLISKKLG*LKHKLDNKEIR 215
G K PYL+N LQ +L+ +GI K + L+ K+DN E+R
Sbjct: 457 GSITKFVPYLYNGLQHSLQDIGI-----KSVKELREKVDNGEVR 495


>tr|A3J785|A3J785_9FLAO Putative uncharacterized protein (Fragment)
OS=Flavobacteria bacterium BAL38 GN=FBBAL38_11960 PE=4
SV=1
Length = 154

Score = 32.7 bits (73), Expect = 9.1
Identities = 22/54 (40%), Positives = 29/54 (53%)
Frame = +3

Query: 96 AMPPSLSSIAMFSKSLYLTKRVVFPYSPL*YSPNLLIGTDLISLLSNLCFNYPN 257
A+P + +I +F+KS + K Y NLLI T +I LLS LCF PN
Sbjct: 96 AVPLTAVAIVLFTKSSDVLKN---------YYKNLLIRTAVIFLLSLLCFLLPN 140