BP919928
Clone id YMU001_000130_G07
Library
Length 468
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000130_G07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAGGATCGTACTTATAAATCCATCCTTGCAATACTGGCAGCAAAGCCCATTTTGGCTCTC
TGTTTTGAGAAAATGGTGATGCATGTAGAGGCGCCCATACTGGTGGATGCCAATGGGACT
GTCTCACATACTTTGACAACAAAAAGAGTCGGGGCACCTGTTGCTGTGAAAGCTTTGTAA
GATGTGGGTTTTTGGAGAGAAGGCTTTTCATGGTAGGGGTCACTTGTGTTCTTTTCAGGG
ATAGCTCTTGGGTATGTTTGAGCAACCCTTGTAATGTAGGTCTCACACTGAAGCAGAGAA
GGGGCAGCATTCTTTTGTTTGATGGGCGGCACATTCTGTGTGTTCGTGTGTATTATGTAG
GTGGTTTTGCAGCTTATGTATGTATCATTGCTCTCTCTAAGAGTCTTTCATAGCTGATAT
GACCTTGTAAGGATGCTTAAGAGTCTGTTCTTTTGGCCTACTTAAGAC
■■Homology search results ■■ -
sp_hit_id Q9CAG5
Definition sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabidopsis thaliana
Align length 77
Score (bit) 31.6
E-value 1.7
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919928|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_G07.
(454 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7 OS=Arabid... 32 1.7
sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rat... 31 2.2
sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=M... 31 2.2
sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=B... 31 2.2
sp|P32257|MED15_KLULA Mediator of RNA polymerase II transcriptio... 31 2.9
sp|B2CJ87|CXS83_CONCB S-superfamily conotoxin Ca8.3 OS=Conus car... 30 3.7
sp|Q14242|SELPL_HUMAN P-selectin glycoprotein ligand 1 OS=Homo s... 30 4.8
sp|Q12N55|LFTR_SHEDO Leucyl/phenylalanyl-tRNA--protein transfera... 30 4.9
sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protei... 30 6.3
sp|Q8C2E7|STRUM_MOUSE Strumpellin OS=Mus musculus GN=Kiaa0196 PE... 30 6.4
sp|Q8BVN4|MTER2_MOUSE mTERF domain-containing protein 2 OS=Mus m... 30 6.4
sp|A2PYL6|HXK2_HORSE Hexokinase-2 OS=Equus caballus GN=HK2 PE=2 ... 30 6.4
sp|A2PYL7|HXK2_EQUZE Hexokinase-2 OS=Equus zebra GN=HK2 PE=2 SV=1 30 6.4
sp|A2PYL8|HXK2_EQUGR Hexokinase-2 OS=Equus grevyi GN=HK2 PE=2 SV=1 30 6.4
sp|P35575|G6PC_HUMAN Glucose-6-phosphatase OS=Homo sapiens GN=G6... 30 6.4
sp|O42153|G6PC_HAPNU Glucose-6-phosphatase OS=Haplochromis nubil... 30 6.4
sp|Q19KA1|G6PC_FELCA Glucose-6-phosphatase OS=Felis silvestris c... 30 6.4
sp|O19133|G6PC_CANFA Glucose-6-phosphatase OS=Canis familiaris G... 30 6.4
sp|Q29RU6|G6PC_BOVIN Glucose-6-phosphatase OS=Bos taurus GN=G6PC... 30 6.4
sp|Q9NQR9|G6PC2_HUMAN Glucose-6-phosphatase 2 OS=Homo sapiens GN... 30 6.4
sp|P98063|BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculu... 29 8.2
sp|P13497|BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapien... 29 8.2
sp|Q7SIG6|ASAP2_MOUSE Arf-GAP with SH3 domain, ANK repeat and PH... 29 8.2
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapien... 29 8.2
sp|P24583|KPC1_YEAST Protein kinase C-like 1 OS=Saccharomyces ce... 29 8.4
sp|A1A5Z0|G6PC3_DANRE Glucose-6-phosphatase 3 OS=Danio rerio GN=... 29 8.4

>sp|Q9CAG5|PUB7_ARATH U-box domain-containing protein 7
OS=Arabidopsis thaliana GN=PUB7 PE=1 SV=1
Length = 782

Score = 31.6 bits (70), Expect = 1.7
Identities = 20/77 (25%), Positives = 31/77 (40%)
Frame = -3

Query: 353 IHTNTQNVPPIKQKNAAPSLLQCETYITRVAQTYPRAIPEKNTSDPYHEKPSLQKPTSYK 174
I++ VPP + + L C+ I QTY R EK SD ++ P Q+ +
Sbjct: 264 INSGQMPVPPEELRCPISLQLMCDPVIIASGQTYERVCIEKWFSDGHNTCPKTQQQLPHI 323

Query: 173 AFTATGAPTLFVVKVCE 123
+ T + CE
Sbjct: 324 SLTPNNCVKGLIASWCE 340


>sp|Q68FV8|UBTD1_RAT Ubiquitin domain-containing protein 1 OS=Rattus
norvegicus GN=Ubtd1 PE=2 SV=1
Length = 227

Score = 31.2 bits (69), Expect = 2.2
Identities = 15/38 (39%), Positives = 25/38 (65%)
Frame = -1

Query: 319 NKRMLPLLCFSVRPTLQGLLKHTQELSLKRTQVTPTMK 206
N+ LP+ C S P + LL+HT+E SL+ + TP+++
Sbjct: 111 NRYQLPIYCLS--PPVNLLLEHTEEESLEPPEPTPSVR 146


>sp|Q91WB7|UBTD1_MOUSE Ubiquitin domain-containing protein 1 OS=Mus
musculus GN=Ubtd1 PE=2 SV=1
Length = 227

Score = 31.2 bits (69), Expect = 2.2
Identities = 15/38 (39%), Positives = 25/38 (65%)
Frame = -1

Query: 319 NKRMLPLLCFSVRPTLQGLLKHTQELSLKRTQVTPTMK 206
N+ LP+ C S P + LL+HT+E SL+ + TP+++
Sbjct: 111 NRYQLPIYCLS--PPVNLLLEHTEEESLEPPEPTPSVR 146


>sp|Q3ZBQ1|UBTD1_BOVIN Ubiquitin domain-containing protein 1 OS=Bos
taurus GN=UBTD1 PE=2 SV=1
Length = 227

Score = 31.2 bits (69), Expect = 2.2
Identities = 15/38 (39%), Positives = 25/38 (65%)
Frame = -1

Query: 319 NKRMLPLLCFSVRPTLQGLLKHTQELSLKRTQVTPTMK 206
N+ LP+ C S P + LL+HT+E SL+ + TP+++
Sbjct: 111 NRYQLPIYCLS--PPVNLLLEHTEEESLEPPEPTPSVR 146


>sp|P32257|MED15_KLULA Mediator of RNA polymerase II transcription
subunit 15 OS=Kluyveromyces lactis GN=GAL11 PE=3 SV=3
Length = 1034

Score = 30.8 bits (68), Expect = 2.9
Identities = 21/69 (30%), Positives = 35/69 (50%), Gaps = 3/69 (4%)
Frame = -1

Query: 271 QGLLKHTQELSLKRTQVTPTMKSLLSKNPHLTK---LSQQQVPRLFLLSKYVRQSHWHPP 101
Q ++T+E L+R Q TM+ + + NP+LT L+QQQ+ + L+ ++ PP
Sbjct: 603 QKYYEYTKEQLLRRQQQLMTMRQMQNNNPNLTANDLLNQQQLLQNRKLNLAMQSQTQEPP 662

Query: 100 VWAPLHASP 74
A P
Sbjct: 663 QIAAQQQQP 671


>sp|B2CJ87|CXS83_CONCB S-superfamily conotoxin Ca8.3 OS=Conus
caracteristicus PE=2 SV=1
Length = 88

Score = 30.4 bits (67), Expect = 3.7
Identities = 16/43 (37%), Positives = 19/43 (44%)
Frame = +3

Query: 99 TGGCQWDCLTYFDNKKSRGTCCCESFVRCGFLERRLFMVGVTC 227
T GC C + D K RGTC C + C + F G TC
Sbjct: 45 TRGCSGTCRRHRDGK-CRGTCECSGYSYCRCGDAHHFYRGCTC 86


>sp|Q14242|SELPL_HUMAN P-selectin glycoprotein ligand 1 OS=Homo
sapiens GN=SELPLG PE=1 SV=1
Length = 412

Score = 30.0 bits (66), Expect = 4.8
Identities = 22/76 (28%), Positives = 30/76 (39%), Gaps = 4/76 (5%)
Frame = -3

Query: 368 KTTYIIHTNTQNVPPIKQKNAAPSLLQCETYITRV----AQTYPRAIPEKNTSDPYHEKP 201
+TT T Q P+ + L E TR+ AQT P A E T+ P +
Sbjct: 122 QTTQPAATEAQTTQPVPTEAQTTPLAATEAQTTRLTATEAQTTPLAATEAQTTPPAATEA 181

Query: 200 SLQKPTSYKAFTATGA 153
+PT +A T A
Sbjct: 182 QTTQPTGLEAQTTAPA 197


>sp|Q12N55|LFTR_SHEDO Leucyl/phenylalanyl-tRNA--protein transferase
OS=Shewanella denitrificans (strain OS217 / ATCC
BAA-1090 / DSM 15013) GN=aat PE=3 SV=1
Length = 233

Score = 30.0 bits (66), Expect = 4.9
Identities = 13/36 (36%), Positives = 19/36 (52%), Gaps = 2/36 (5%)
Frame = -1

Query: 190 NPHLTKLSQQQVPRLFLLSKYVRQSHWHPP--VWAP 89
NPHL +L + +PR L++ + H H P W P
Sbjct: 191 NPHLARLGAKPLPREAFLTQLAQLKHQHSPATAWQP 226


>sp|P87319|VP13A_SCHPO Vacuolar protein sorting-associated protein 13a
OS=Schizosaccharomyces pombe GN=vps13a PE=2 SV=2
Length = 3011

Score = 29.6 bits (65), Expect = 6.3
Identities = 19/58 (32%), Positives = 30/58 (51%)
Frame = -3

Query: 326 PIKQKNAAPSLLQCETYITRVAQTYPRAIPEKNTSDPYHEKPSLQKPTSYKAFTATGA 153
PI +KN+ S+ CE IT+V + A+P + D E+ ++ +Y A TGA
Sbjct: 1226 PIVEKNSKKSIFSCE--ITKV--EFHTAVPSSSHHDVLMEENNVHLDLTYDANYTTGA 1279


>sp|Q8C2E7|STRUM_MOUSE Strumpellin OS=Mus musculus GN=Kiaa0196 PE=2
SV=2
Length = 1159

Score = 29.6 bits (65), Expect = 6.4
Identities = 15/36 (41%), Positives = 20/36 (55%)
Frame = -1

Query: 301 LLCFSVRPTLQGLLKHTQELSLKRTQVTPTMKSLLS 194
LLCF + LQ L Q++ LK V T+K L+S
Sbjct: 879 LLCFMIVKELQNFLSMFQKIILKERTVQETLKMLMS 914


tr_hit_id B7QH86
Definition tr|B7QH86|B7QH86_IXOSC Secreted salivary gland peptide, putative OS=Ixodes scapularis
Align length 94
Score (bit) 37.0
E-value 0.49
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919928|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_G07.
(454 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B7QH86|B7QH86_IXOSC Secreted salivary gland peptide, putative... 37 0.49
tr|B6N836|B6N836_BRAFL Putative uncharacterized protein (Fragmen... 36 1.1
tr|B6NK27|B6NK27_BRAFL Putative uncharacterized protein OS=Branc... 35 1.9
tr|Q4WX48|Q4WX48_ASPFU Putative uncharacterized protein OS=Asper... 34 3.2
tr|B0XYH1|B0XYH1_ASPFC Putative uncharacterized protein OS=Asper... 34 3.2
tr|A0DU40|A0DU40_PARTE Chromosome undetermined scaffold_64, whol... 34 4.2
tr|Q4Q6S6|Q4Q6S6_LEIMA Putative uncharacterized protein OS=Leish... 34 4.2
tr|B4KKY8|B4KKY8_DROMO GI17300 OS=Drosophila mojavensis GN=GI173... 33 5.4
tr|A1D7M8|A1D7M8_NEOFI Putative uncharacterized protein OS=Neosa... 33 5.4
tr|B6L9U8|B6L9U8_BRAFL Putative uncharacterized protein OS=Branc... 33 5.5
tr|Q24GL8|Q24GL8_TETTH Putative uncharacterized protein OS=Tetra... 33 7.1
tr|B3N3W5|B3N3W5_DROER GG23771 OS=Drosophila erecta GN=GG23771 P... 33 7.1
tr|Q8Z0F4|Q8Z0F4_ANASP All0143 protein OS=Anabaena sp. (strain P... 33 9.3
tr|A9RZF8|A9RZF8_PHYPA Predicted protein (Fragment) OS=Physcomit... 33 9.3
tr|B4F6X1|B4F6X1_XENTR LOC100145628 protein OS=Xenopus tropicali... 33 9.3
tr|B1H3G9|B1H3G9_XENTR LOC100145628 protein OS=Xenopus tropicali... 33 9.3
tr|B4MUV1|B4MUV1_DROWI GK14736 OS=Drosophila willistoni GN=GK147... 33 9.3
tr|O50085|O50085_PYRHO Putative uncharacterized protein PH1377 O... 33 9.3

>tr|B7QH86|B7QH86_IXOSC Secreted salivary gland peptide, putative
OS=Ixodes scapularis GN=IscW_ISCW013779 PE=4 SV=1
Length = 435

Score = 37.0 bits (84), Expect = 0.49
Identities = 25/94 (26%), Positives = 41/94 (43%), Gaps = 1/94 (1%)
Frame = -3

Query: 353 IHTNTQNVPPIKQKNAAPSLLQCETYITRVAQTYPRAIPEKNTSDPYHEKPSLQK-PTSY 177
+ T+ P + +AAP++ + +TY T A T ++ P + D YH P++ T+
Sbjct: 61 VSTSYHASPAVTTVSAAPAVSRVDTYHTAPAVTTYQSAPAVSRVDTYHTAPAVATYQTAP 120

Query: 176 KAFTATGAPTLFVVKVCETVPLASTSMGASTCIT 75
T AP + V T P +T A T
Sbjct: 121 AVATYQSAPAVSRVDTYHTAPAVATYQAAPAVAT 154


>tr|B6N836|B6N836_BRAFL Putative uncharacterized protein (Fragment)
OS=Branchiostoma floridae GN=BRAFLDRAFT_126439 PE=4 SV=1
Length = 1911

Score = 35.8 bits (81), Expect = 1.1
Identities = 31/108 (28%), Positives = 50/108 (46%), Gaps = 4/108 (3%)
Frame = -1

Query: 340 HRMCRPSNKRMLPLLCFSVRPTLQGLLKHTQELSLKRTQVTPTMKSLLSKNPHLTKLSQQ 161
H + S LP L + + H L L + TM SLLS++PH++ L
Sbjct: 1117 HTLFHTSILDRLPSLSHTYMSSCVSATPHIAILPLLPSPPHTTMPSLLSRSPHISILRLL 1176

Query: 160 QV-PRLFLLSKYVRQSHWH--PPVWAPLHAS-PFSQNREPKWALLPVL 29
+ P + + S+ R H PP+ P + S P +R P+ ++LP+L
Sbjct: 1177 SIPPHISMPSRLSRPPHTPILPPLSIPPNMSMPSLLSRSPQSSILPLL 1224


>tr|B6NK27|B6NK27_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_96070 PE=4 SV=1
Length = 994

Score = 35.0 bits (79), Expect = 1.9
Identities = 27/109 (24%), Positives = 45/109 (41%), Gaps = 5/109 (4%)
Frame = -1

Query: 340 HRMCRPSNKRMLPLLCFSVRPTLQGLLKHTQELSLKRTQVTPTMKSLLSKNPHLTKLSQQ 161
H + S LP L + + H L L + TM SLLS++PH++ L
Sbjct: 371 HTLFHTSILDRLPSLSHTYMSSCVSATPHIAILPLLPSPPHTTMPSLLSRSPHISILRLL 430

Query: 160 QVPRLFLLSKYVRQSHWHPPVWAPLHASPFSQ-----NREPKWALLPVL 29
+P + + + H + PL P +R P+ ++LP+L
Sbjct: 431 SIPPHISMPSRLSRRPPHTSILPPLSIPPIMSMPSLLSRSPQSSILPLL 479


>tr|Q4WX48|Q4WX48_ASPFU Putative uncharacterized protein
OS=Aspergillus fumigatus GN=AFUA_3G08210 PE=4 SV=1
Length = 478

Score = 34.3 bits (77), Expect = 3.2
Identities = 32/96 (33%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
Frame = -1

Query: 304 PLLCFSVRPTLQGLLKHTQELSLKRTQ--VTPTMK--SLLSKNPHLTKLSQQQVPRLFLL 137
P+ S L GL+ H SL R + V P K ++ S +P L+ LSQ L
Sbjct: 98 PVFVRSASDDLPGLVDHPPVSSLDRAEPIVDPCAKQSTIASYSPSLS-LSQHA------L 150

Query: 136 SKYVRQSHWHPPVWAPLHASPFSQNREPKWALLPVL 29
S + PP WA A P RE KW P L
Sbjct: 151 SVSKDDRYGSPPEWAQKRAGPNHYFREKKWDFFPEL 186


>tr|B0XYH1|B0XYH1_ASPFC Putative uncharacterized protein
OS=Aspergillus fumigatus (strain CEA10 / CBS 144.89 /
FGSC A1163) GN=AFUB_040900 PE=4 SV=1
Length = 478

Score = 34.3 bits (77), Expect = 3.2
Identities = 32/96 (33%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
Frame = -1

Query: 304 PLLCFSVRPTLQGLLKHTQELSLKRTQ--VTPTMK--SLLSKNPHLTKLSQQQVPRLFLL 137
P+ S L GL+ H SL R + V P K ++ S +P L+ LSQ L
Sbjct: 98 PVFVRSASDDLPGLVDHPPVSSLDRAEPIVDPCAKQSTIASYSPSLS-LSQHA------L 150

Query: 136 SKYVRQSHWHPPVWAPLHASPFSQNREPKWALLPVL 29
S + PP WA A P RE KW P L
Sbjct: 151 SVSKDDRYGSPPEWAQKRAGPNHYFREKKWDFFPEL 186


>tr|A0DU40|A0DU40_PARTE Chromosome undetermined scaffold_64, whole
genome shotgun sequence OS=Paramecium tetraurelia
GN=GSPATT00020228001 PE=4 SV=1
Length = 374

Score = 33.9 bits (76), Expect = 4.2
Identities = 29/108 (26%), Positives = 51/108 (47%), Gaps = 3/108 (2%)
Frame = -1

Query: 412 YERLLERAMIHT*AAKPPT*YTRTHRM---CRPSNKRMLPLLCFSVRPTLQGLLKHTQEL 242
YERL++ +I T A + ++ ++ S K L L ++ L+ LK + L
Sbjct: 239 YERLIQ--IIETEGALESSSKSKLFKLIDVATKSTKVPLQTLARIIQSVLRACLKESCSL 296

Query: 241 SLKRTQVTPTMKSLLSKNPHLTKLSQQQVPRLFLLSKYVRQSHWHPPV 98
L TQ+ + ++ K+ L QQ +L ++ Y Q+HWHP +
Sbjct: 297 QLAATQI---IFNIFKKHVQLKHFLQQGEAQLVEIASY--QNHWHPEI 339


>tr|Q4Q6S6|Q4Q6S6_LEIMA Putative uncharacterized protein
OS=Leishmania major GN=LmjF30.3620 PE=4 SV=1
Length = 370

Score = 33.9 bits (76), Expect = 4.2
Identities = 32/120 (26%), Positives = 50/120 (41%), Gaps = 3/120 (2%)
Frame = -3

Query: 452 KNRLLSILTRSYQL*KTLRESNDTYISCKTTYIIHTNTQNVPPIKQKNAAPSLLQCETYI 273
K L++L QL + +E + +++S + ++ PP AAPS L +
Sbjct: 77 KQESLNVLLAKLQLCRPAQEPS-SHLSAAAKPLPQSSANATPPAVPSAAAPSALHPTACV 135

Query: 272 TRVAQTYPRAIPEKNTSDPYHEKP--SLQKPT-SYKAFTATGAPTLFVVKVCETVPLAST 102
A AI + SDP P S P+ ++ T T P VVK E V +S+
Sbjct: 136 ASPAAAASPAIGMREVSDPSFPDPKESSSGPSGQFEFITGTNIPGQGVVKKTEAVDESSS 195


>tr|B4KKY8|B4KKY8_DROMO GI17300 OS=Drosophila mojavensis GN=GI17300
PE=4 SV=1
Length = 323

Score = 33.5 bits (75), Expect = 5.4
Identities = 31/112 (27%), Positives = 46/112 (41%), Gaps = 15/112 (13%)
Frame = -1

Query: 328 RPSNKRMLPLL-CFSVRPTLQGLLKHTQELSLKRTQVTPTMKSLLSKNPHLTK------- 173
R SN+R L C + T L KH + S +RT + P + N +L K
Sbjct: 134 RHSNERTLSCPHCPKLFATKDNLQKHIRRHSSERTLICPHCPKAFATNDNLQKHIRRHSS 193

Query: 172 ---LSQQQVPRLFL----LSKYVRQSHWHPPVWAPLHASPFSQNREPKWALL 38
L+ P+ F L +++R P P PF+QNR+ K +L
Sbjct: 194 ERTLNCPHCPKAFATNDNLQRHIRGHTGERPFKCPYCPKPFAQNRDLKAHIL 245


>tr|A1D7M8|A1D7M8_NEOFI Putative uncharacterized protein
OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 /
NRRL 181) GN=NFIA_068930 PE=4 SV=1
Length = 480

Score = 33.5 bits (75), Expect = 5.4
Identities = 32/96 (33%), Positives = 40/96 (41%), Gaps = 4/96 (4%)
Frame = -1

Query: 304 PLLCFSVRPTLQGLLKHTQELSLKRTQ--VTPTMK--SLLSKNPHLTKLSQQQVPRLFLL 137
P+ S L GL+ H SL R + V P K ++ S +P L+ LSQ L
Sbjct: 98 PVFVRSPSDDLAGLVDHPPVSSLDRAEPIVDPCAKPSTIASYSPSLS-LSQHA------L 150

Query: 136 SKYVRQSHWHPPVWAPLHASPFSQNREPKWALLPVL 29
S + PP WA A P RE KW P L
Sbjct: 151 SVSKDDRYGSPPEWAQKRAGPNHYFREKKWDFFPEL 186


>tr|B6L9U8|B6L9U8_BRAFL Putative uncharacterized protein
OS=Branchiostoma floridae GN=BRAFLDRAFT_67925 PE=4 SV=1
Length = 6036

Score = 33.5 bits (75), Expect = 5.5
Identities = 34/130 (26%), Positives = 50/130 (38%), Gaps = 1/130 (0%)
Frame = -3

Query: 428 TRSYQL*KTLRESNDTYISCKTTYIIHTNTQNVPPIKQKNAAPSLLQCETYITRVAQTYP 249
T + L T E+ T S TT IHT PP + + +L T T T
Sbjct: 3828 TTTKPLTTTAGETTTTIASATTTPTIHTEIITQPPTTEHSTEVQVL---TTTTAATTTTK 3884

Query: 248 RAIPEKNTSDPYHEKPSLQKPTSYKAFTATGAP-TLFVVKVCETVPLASTSMGASTCITI 72
A K S +P+ TS + FT P ++ T P+ T A+T +
Sbjct: 3885 PATTTKPISTQVVTEPTTGMTTSSQVFTTQSVPEETTTLEATTTKPITQTF--ATTTAST 3942

Query: 71 FSKQRAKMGF 42
F+ Q + G+
Sbjct: 3943 FAPQCLQDGY 3952