BP919935
Clone id YMU001_000130_H03
Library
Length 418
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000130_H03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
GCGGGGACTCACAACCATGGCTAGCTCCTTGCGAGATCTCGAGCTTCTCATGGATTACAA
CACAAAGCTTGTCTCTTCTGCGGCCTCCCCTGTAGCAGCAGCTCACATTTCTTCATCTCT
ACCAATTGCTTCAACAGAAACGGAAGCACAAGGACTGGAAGAGCAGGCTCTGGCGTTACA
GAATCATCGCCAGCACGCAGTATCTTTTCACCATCGCCCTTCCCTGCTTGCCTCCCTTTC
CCTTGCCTTTGGTCCCGTCCTCTCCTTCAACCCTTGCCTCTCCAAATCGAGAGTTATGGC
TGCAAATTCAATAGCTTCTTCTGGAGCGAAGCTTCTCTCACAAAAGAAATGTATTAGCCC
TACCCCTGTGATGCCAGCAATATCTGCGGCAACAACGTATCTGGATATGGAAGGGGCA
■■Homology search results ■■ -
sp_hit_id P70211
Definition sp|P70211|DCC_MOUSE Netrin receptor DCC OS=Mus musculus
Align length 90
Score (bit) 31.6
E-value 1.3
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919935|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_H03.
(418 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|P70211|DCC_MOUSE Netrin receptor DCC OS=Mus musculus GN=Dcc P... 32 1.3
sp|Q556Y7|LYSD_DICDI Lysozyme D OS=Dictyostelium discoideum GN=a... 31 2.2
sp|P43146|DCC_HUMAN Netrin receptor DCC OS=Homo sapiens GN=DCC P... 31 2.2
sp|Q8N1L1|CV037_HUMAN Putative uncharacterized protein C22orf37 ... 31 2.2
sp|P47777|CD59_SAISC CD59 glycoprotein OS=Saimiri sciureus GN=CD... 31 2.2
sp|Q59MJ2|MCH1_CANAL Probable transporter MCH1 OS=Candida albica... 30 2.9
sp|P02836|HMEN_DROME Segmentation polarity homeobox protein engr... 30 2.9
sp|Q5RCR9|CSTP1_PONAB Uncharacterized metallophosphoesterase CST... 30 2.9
sp|Q9BRF8|CSTP1_HUMAN Uncharacterized metallophosphoesterase CST... 30 2.9
sp|Q9DA04|TMM89_MOUSE Transmembrane protein 89 OS=Mus musculus G... 30 3.8
sp|Q5M7P5|NOL6_XENTR Nucleolar protein 6 OS=Xenopus tropicalis G... 29 6.4
sp|Q9QJ16|IE2_HHV6Z Immediate-early protein 2 OS=Human herpesvir... 29 6.4
sp|Q8R1H8|BATF2_MOUSE Basic leucine zipper transcriptional facto... 29 6.4
sp|Q8N1G0|ZN687_HUMAN Zinc finger protein 687 OS=Homo sapiens GN... 29 8.4
sp|Q924T7|RNF31_MOUSE RING finger protein 31 OS=Mus musculus GN=... 29 8.4
sp|Q99J85|NPTXR_MOUSE Neuronal pentraxin receptor OS=Mus musculu... 29 8.4
sp|P51611|HCFC1_MESAU Host cell factor OS=Mesocricetus auratus G... 29 8.4
sp|P04725|GDA5_WHEAT Alpha/beta-gliadin A-V OS=Triticum aestivum... 29 8.4
sp|Q54YH4|DHKB_DICDI Hybrid signal transduction histidine kinase... 29 8.4
sp|P24452|CAPG_MOUSE Macrophage-capping protein OS=Mus musculus ... 29 8.4
sp|Q8C4A5|ASXL3_MOUSE Putative Polycomb group protein ASXL3 OS=M... 29 8.4

>sp|P70211|DCC_MOUSE Netrin receptor DCC OS=Mus musculus GN=Dcc PE=1
SV=1
Length = 1447

Score = 31.6 bits (70), Expect = 1.3
Identities = 27/90 (30%), Positives = 40/90 (44%), Gaps = 7/90 (7%)
Frame = +1

Query: 97 SSSHFFISTNCFNRNGSTRTGRAGSGVTESSPARSIFSPSP----FPACLPFPCLW---S 255
SSSH+ IS FN G G + ES+ RSI P+ +P FP S
Sbjct: 788 SSSHYVISLKAFNNAGE------GVPLYESATTRSITDPTDPVDYYPLLDDFPTSGPDVS 841

Query: 256 RPLLQPLPLQIESYGCKFNSFFWSEASLTK 345
P+L P+ +Q + + W++ S+ K
Sbjct: 842 TPMLPPVGVQAVALTHEAVRVSWADNSVPK 871


>sp|Q556Y7|LYSD_DICDI Lysozyme D OS=Dictyostelium discoideum
GN=alyD-1 PE=3 SV=1
Length = 260

Score = 30.8 bits (68), Expect = 2.2
Identities = 17/47 (36%), Positives = 21/47 (44%), Gaps = 10/47 (21%)
Frame = +1

Query: 79 CGLPCSSSSHFFIS----------TNCFNRNGSTRTGRAGSGVTESS 189
CG PCS+ ++F T C GST TG GS T +S
Sbjct: 52 CGTPCSAQTYFTADSQRFGCGVTLTICSTSGGSTTTGGTGSAGTSTS 98


>sp|P43146|DCC_HUMAN Netrin receptor DCC OS=Homo sapiens GN=DCC PE=1
SV=1
Length = 1447

Score = 30.8 bits (68), Expect = 2.2
Identities = 27/90 (30%), Positives = 39/90 (43%), Gaps = 7/90 (7%)
Frame = +1

Query: 97 SSSHFFISTNCFNRNGSTRTGRAGSGVTESSPARSIFSPSP----FPACLPFPCL---WS 255
SSSH+ IS FN G G + ES+ RSI P+ +P FP S
Sbjct: 788 SSSHYVISLKAFNNAGE------GVPLYESATTRSITDPTDPVDYYPLLDDFPTSVPDLS 841

Query: 256 RPLLQPLPLQIESYGCKFNSFFWSEASLTK 345
P+L P+ +Q + W++ S+ K
Sbjct: 842 TPMLPPVGVQAVALTHDAVRVSWADNSVPK 871


>sp|Q8N1L1|CV037_HUMAN Putative uncharacterized protein C22orf37
OS=Homo sapiens GN=C22orf37 PE=2 SV=1
Length = 170

Score = 30.8 bits (68), Expect = 2.2
Identities = 36/124 (29%), Positives = 52/124 (41%), Gaps = 17/124 (13%)
Frame = +1

Query: 25 LLARSRASHGLQHKACLFCGLPCSS--SSHFFIST--NCFNRNGSTRTGRAGSGVTESSP 192
L AR R G Q ++ LP + + F ++ + +G+ RT S ++ SP
Sbjct: 29 LCARERGVRGTQPCPRIYLRLPAQNCEETRFCCASPGSVVLGHGAPRTASPPSALSHPSP 88

Query: 193 ARSI-FSPSPFPACLPFP------------CLWSRPLLQPLPLQIESYGCKFNSFFWSEA 333
+ FSP P P+ L P CL S L ES GC +NS WS +
Sbjct: 89 LEGLSFSPFP-PSVLSHPSPPEGLSFSLFHCLCSGKLS-------ESPGCFWNSLGWSFS 140

Query: 334 SLTK 345
LT+
Sbjct: 141 VLTE 144


>sp|P47777|CD59_SAISC CD59 glycoprotein OS=Saimiri sciureus GN=CD59
PE=2 SV=1
Length = 131

Score = 30.8 bits (68), Expect = 2.2
Identities = 19/53 (35%), Positives = 22/53 (41%)
Frame = +1

Query: 19 G*LLARSRASHGLQHKACLFCGLPCSSSSHFFISTNCFNRNGSTRTGRAGSGV 177
G LL + H C C LP S STNC + S +AGSGV
Sbjct: 11 GLLLVLAVFCHSGNSLQCYSCPLPTMESMECTASTNCTSNLDSCLIAKAGSGV 63


>sp|Q59MJ2|MCH1_CANAL Probable transporter MCH1 OS=Candida albicans
GN=MCH1 PE=3 SV=1
Length = 436

Score = 30.4 bits (67), Expect = 2.9
Identities = 28/74 (37%), Positives = 37/74 (50%), Gaps = 16/74 (21%)
Frame = +2

Query: 164 QALALQNHRQHAVSFHHRPS---LLASLSLAFGPVLSFNPCLS-------------KSRV 295
++L NHRQ VSF PS LL SL L GP+ S+ LS + +
Sbjct: 238 RSLEPPNHRQRFVSFVKDPSAWILLVSLILNIGPMESYQNNLSSILKHTNGADLPNQVSI 297

Query: 296 MAANSIASSGAKLL 337
MAA +S+GA+LL
Sbjct: 298 MAA---SSTGARLL 308


>sp|P02836|HMEN_DROME Segmentation polarity homeobox protein
engrailed OS=Drosophila melanogaster GN=en PE=1 SV=2
Length = 552

Score = 30.4 bits (67), Expect = 2.9
Identities = 18/44 (40%), Positives = 23/44 (52%)
Frame = +1

Query: 94 SSSSHFFISTNCFNRNGSTRTGRAGSGVTESSPARSIFSPSPFP 225
SSSS + + N + S+R G +GSGV SSP P P P
Sbjct: 350 SSSSGCSSAASSLNSSPSSRLGASGSGVNASSP-----QPQPIP 388


>sp|Q5RCR9|CSTP1_PONAB Uncharacterized metallophosphoesterase CSTP1
OS=Pongo abelii GN=CSTP1 PE=2 SV=1
Length = 314

Score = 30.4 bits (67), Expect = 2.9
Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
Frame = +2

Query: 137 ETEAQGLEEQ-ALALQNHRQHAVSFHHRPSLLASL 238
+ + Q L+EQ ++A Q H QHA+ F H P L S+
Sbjct: 179 QAQDQWLDEQLSIARQRHCQHAIIFQHIPLFLESI 213


>sp|Q9BRF8|CSTP1_HUMAN Uncharacterized metallophosphoesterase CSTP1
OS=Homo sapiens GN=CSTP1 PE=1 SV=2
Length = 314

Score = 30.4 bits (67), Expect = 2.9
Identities = 15/35 (42%), Positives = 22/35 (62%), Gaps = 1/35 (2%)
Frame = +2

Query: 137 ETEAQGLEEQ-ALALQNHRQHAVSFHHRPSLLASL 238
+ + Q L+EQ ++A Q H QHA+ F H P L S+
Sbjct: 179 QAQDQWLDEQLSIARQRHCQHAIVFQHIPLFLESI 213


>sp|Q9DA04|TMM89_MOUSE Transmembrane protein 89 OS=Mus musculus
GN=Tmem89 PE=2 SV=2
Length = 169

Score = 30.0 bits (66), Expect = 3.8
Identities = 15/36 (41%), Positives = 21/36 (58%), Gaps = 1/36 (2%)
Frame = +1

Query: 211 PSPFPACLPFPCL-WSRPLLQPLPLQIESYGCKFNS 315
PS F +P P WSRPL + L ++ +GC+ NS
Sbjct: 9 PSLFLLVMPVPSQGWSRPLWYQVGLDLQPWGCQPNS 44


tr_hit_id A9S2A4
Definition tr|A9S2A4|A9S2A4_PHYPA Predicted protein OS=Physcomitrella patens subsp. patens
Align length 133
Score (bit) 47.4
E-value 0.0004
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919935|Adiantum capillus-veneris mRNA, clone:
YMU001_000130_H03.
(418 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A9S2A4|A9S2A4_PHYPA Predicted protein OS=Physcomitrella paten... 47 4e-04
tr|Q17M37|Q17M37_AEDAE Putative uncharacterized protein OS=Aedes... 37 0.49
tr|B6KBE5|B6KBE5_TOXGO 2OG-Fe(II) oxygenase family oxidoreductas... 37 0.64
tr|B0WEK8|B0WEK8_CULQU Putative uncharacterized protein OS=Culex... 36 0.83
tr|A9WDB2|A9WDB2_CHLAA Response regulator receiver OS=Chloroflex... 35 1.9
tr|B2QP76|B2QP76_9CHLR Adenylate/guanylate cyclase with GAF sens... 35 1.9
tr|B3MS41|B3MS41_DROAN GF20874 OS=Drosophila ananassae GN=GF2087... 35 1.9
tr|B4M079|B4M079_DROVI GJ23193 OS=Drosophila virilis GN=GJ23193 ... 33 5.4
tr|Q0V1I0|Q0V1I0_PHANO Putative uncharacterized protein OS=Phaeo... 33 5.4
tr|Q4DMK6|Q4DMK6_TRYCR Putative uncharacterized protein OS=Trypa... 33 7.0
tr|B4LL59|B4LL59_DROVI GJ22288 OS=Drosophila virilis GN=GJ22288 ... 33 7.0
tr|B5DX84|B5DX84_DROPS GA27565 OS=Drosophila pseudoobscura pseud... 33 9.2
tr|B4GLK3|B4GLK3_DROPE GL12588 OS=Drosophila persimilis GN=GL125... 33 9.2

>tr|A9S2A4|A9S2A4_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHR2a PE=4 SV=1
Length = 528

Score = 47.4 bits (111), Expect = 4e-04
Identities = 47/133 (35%), Positives = 61/133 (45%), Gaps = 6/133 (4%)
Frame = +2

Query: 29 LRDLELLMDYNTKLVXXXXXXXXXXXXXXXLPIASTETEAQGLEEQALALQNHRQHAVSF 208
L DLEL++D N A+T E + EE+A+A + A SF
Sbjct: 7 LDDLELILDRNLHRALAASRTNAPAPPWTNSGAAATGAEVEDDEEEAVASKEEVADAASF 66

Query: 209 HHRPSLLASLSLAFGPVLSFNPCLSKSRVMAANS------IASSGAKLLSQKKCISPTPV 370
+ ASLSLA VL+ + LSK+ V+ S A SGA + SQKK SP PV
Sbjct: 67 GNPLPSAASLSLALNSVLTSSLILSKNNVVPQASQRGGVGPAISGA-VPSQKKSHSPVPV 125

Query: 371 MPAISAATTYLDM 409
M A S LD+
Sbjct: 126 M-ASSKVQVALDI 137


>tr|Q17M37|Q17M37_AEDAE Putative uncharacterized protein OS=Aedes
aegypti GN=AAEL001147 PE=4 SV=1
Length = 2386

Score = 37.0 bits (84), Expect = 0.49
Identities = 27/94 (28%), Positives = 48/94 (51%), Gaps = 11/94 (11%)
Frame = +2

Query: 125 IASTETEAQGLEEQALALQNHRQHAVSFHHRPSLLASLSLAFGPVLSFNPCLSKSRVMAA 304
I +TE A+ + ++ + A++ H+ P L A L+ AFG + S NP L+ R++A
Sbjct: 393 IKTTEQNAEKMSNMIRTWIDNYERAITNHYSPELRARLT-AFGKMQSQNPLLNSDRLIAP 451

Query: 305 NSIAS----------SGAKLLSQKKCISP-TPVM 373
S+ + +G K+L + I P TP++
Sbjct: 452 GSVINLAQKCTTVPHAGGKILISIEEIPPKTPII 485


>tr|B6KBE5|B6KBE5_TOXGO 2OG-Fe(II) oxygenase family oxidoreductase,
putative OS=Toxoplasma gondii ME49 GN=TGME49_059150 PE=4
SV=1
Length = 1658

Score = 36.6 bits (83), Expect = 0.64
Identities = 33/115 (28%), Positives = 48/115 (41%), Gaps = 9/115 (7%)
Frame = +1

Query: 67 ACLFCGLPCSSSSHFFISTNCFNRNGSTRTGRAGSGVTESSPARSIFSPSP---FPAC-- 231
+C CG SS++H +S + TR R+ T S R SPSP AC
Sbjct: 391 SCSSCGSDSSSNTHRSLSRLSAS---PTRPARSPCVQTSFSKCRDTASPSPPRKASACAS 447

Query: 232 -LPF---PCLWSRPLLQPLPLQIESYGCKFNSFFWSEASLTKEMY*PYPCDASNI 384
LP PC WS P PL C+ ++ SE++L P ++++
Sbjct: 448 RLPCGLSPCRWSASCFPPEPLSCPDGSCRPVAYARSESTLCSAQRPSAPSSSTSV 502


>tr|B0WEK8|B0WEK8_CULQU Putative uncharacterized protein OS=Culex
quinquefasciatus GN=CpipJ_CPIJ005719 PE=4 SV=1
Length = 3080

Score = 36.2 bits (82), Expect = 0.83
Identities = 26/94 (27%), Positives = 46/94 (48%), Gaps = 11/94 (11%)
Frame = +2

Query: 125 IASTETEAQGLEEQALALQNHRQHAVSFHHRPSLLASLSLAFGPVLSFNPCLSKSRVMAA 304
+ +TE A+ + ++ + A++ H+ P L A L AFG + S NP L+ R++ A
Sbjct: 1094 VKTTEQNAEKMSNMIRTWIDNYERAITNHYSPELRARLQ-AFGKMQSQNPLLNSDRLIPA 1152

Query: 305 NSIAS----------SGAKLLSQKKCISP-TPVM 373
S+ + +G K+L I P TP++
Sbjct: 1153 ASVTNLMQKCTTVPHAGGKILISTGDIEPKTPII 1186


>tr|A9WDB2|A9WDB2_CHLAA Response regulator receiver OS=Chloroflexus
aurantiacus (strain ATCC 29366 / DSM 635 / J-10-fl)
GN=Caur_1862 PE=4 SV=1
Length = 981

Score = 35.0 bits (79), Expect = 1.9
Identities = 24/81 (29%), Positives = 40/81 (49%)
Frame = +2

Query: 176 LQNHRQHAVSFHHRPSLLASLSLAFGPVLSFNPCLSKSRVMAANSIASSGAKLLSQKKCI 355
++N R + + R +L A L A P+L +P ++R++ ANS A S ++ +
Sbjct: 631 VENARLYQIVNDERSTLNAILQSATDPILLIDP---QARLLLANSAALSRLQIDQKTHYG 687

Query: 356 SPTPVMPAISAATTYLDMEGA 418
P PA+ A LD EG+
Sbjct: 688 QPVDQFPALRAILPALDQEGS 708


>tr|B2QP76|B2QP76_9CHLR Adenylate/guanylate cyclase with GAF
sensor(S) OS=Chloroflexus sp. Y-400-fl
GN=Chy400DRAFT_2791 PE=4 SV=1
Length = 981

Score = 35.0 bits (79), Expect = 1.9
Identities = 24/81 (29%), Positives = 40/81 (49%)
Frame = +2

Query: 176 LQNHRQHAVSFHHRPSLLASLSLAFGPVLSFNPCLSKSRVMAANSIASSGAKLLSQKKCI 355
++N R + + R +L A L A P+L +P ++R++ ANS A S ++ +
Sbjct: 631 VENARLYQIVNDERSTLNAILQSATDPILLIDP---QARLLLANSAALSRLQIDQKTHYG 687

Query: 356 SPTPVMPAISAATTYLDMEGA 418
P PA+ A LD EG+
Sbjct: 688 QPVDQFPALRAILPALDQEGS 708


>tr|B3MS41|B3MS41_DROAN GF20874 OS=Drosophila ananassae GN=GF20874
PE=4 SV=1
Length = 1186

Score = 35.0 bits (79), Expect = 1.9
Identities = 17/37 (45%), Positives = 22/37 (59%)
Frame = +1

Query: 118 STNCFNRNGSTRTGRAGSGVTESSPARSIFSPSPFPA 228
S NCF+ NGS+ R+GSG S+ A + PS PA
Sbjct: 560 SVNCFSGNGSSSGNRSGSGSGSSNSASPLSPPSGAPA 596


>tr|B4M079|B4M079_DROVI GJ23193 OS=Drosophila virilis GN=GJ23193
PE=4 SV=1
Length = 1519

Score = 33.5 bits (75), Expect = 5.4
Identities = 19/66 (28%), Positives = 33/66 (50%), Gaps = 7/66 (10%)
Frame = +1

Query: 118 STNCFNRNGSTRTGRAGSGVTESSP-------ARSIFSPSPFPACLPFPCLWSRPLLQPL 276
++N N++G++R + +G T+ + A S P+P PA +P P P PL
Sbjct: 289 TSNSNNKSGNSRPAQETAGATQPAAQKPTGVVATSTSMPTPMPAPMPTPMPAPMPTPMPL 348

Query: 277 PLQIES 294
P+ + S
Sbjct: 349 PMPMPS 354


>tr|Q0V1I0|Q0V1I0_PHANO Putative uncharacterized protein
OS=Phaeosphaeria nodorum GN=SNOG_02134 PE=3 SV=2
Length = 4118

Score = 33.5 bits (75), Expect = 5.4
Identities = 15/39 (38%), Positives = 23/39 (58%)
Frame = +2

Query: 212 HRPSLLASLSLAFGPVLSFNPCLSKSRVMAANSIASSGA 328
HRPS+LAS ++A +++ PC R M + +A GA
Sbjct: 1559 HRPSVLASCNVANEDIVAIRPCTPLQRGMISQMLAKEGA 1597


>tr|Q4DMK6|Q4DMK6_TRYCR Putative uncharacterized protein
OS=Trypanosoma cruzi GN=Tc00.1047053504021.140 PE=4 SV=1
Length = 788

Score = 33.1 bits (74), Expect = 7.0
Identities = 16/41 (39%), Positives = 25/41 (60%)
Frame = +1

Query: 88 PCSSSSHFFISTNCFNRNGSTRTGRAGSGVTESSPARSIFS 210
P ++++ IS++ N NGST+ G AG G ++P R FS
Sbjct: 503 PIAAAASATISSSNANNNGSTQAGSAGGGAQAAAPNRLRFS 543