BP919961
Clone id YMU001_000131_C08
Library
Length 244
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000131_C08.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
GGATCAACCGGCCAAAATCATTGACGCACATGAGCCATCCATTCCCTCAAGGGAAACAAT
CCCAGCCAGGTTGAGGTTCGAACTCACTCCATGCCAATTGGAGAGGACGGGCCTTCCCAT
TACACCAGTGCTTGCGACTCGATAGTAGGTTGGCAACTAAAGTTGTATGATGAGCTTCAA
GTTTCGCCGTCGCCGCGACTAACCTCTGTACACATACCAAAAGCTACCCTTGGATCAAAA
ACAT
■■Homology search results ■■ -
sp_hit_id O75912
Definition sp|O75912|DGKI_HUMAN Diacylglycerol kinase iota OS=Homo sapiens
Align length 20
Score (bit) 30.4
E-value 2.9
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919961|Adiantum capillus-veneris mRNA, clone:
YMU001_000131_C08.
(244 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|O75912|DGKI_HUMAN Diacylglycerol kinase iota OS=Homo sapiens ... 30 2.9
sp|Q3TQQ9|CA112_MOUSE Uncharacterized protein C1orf112 homolog O... 30 3.7
sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza sa... 30 4.9
sp|Q96JB2|COG3_HUMAN Conserved oligomeric Golgi complex subunit ... 29 8.3

>sp|O75912|DGKI_HUMAN Diacylglycerol kinase iota OS=Homo sapiens
GN=DGKI PE=1 SV=1
Length = 1065

Score = 30.4 bits (67), Expect = 2.9
Identities = 12/20 (60%), Positives = 14/20 (70%)
Frame = +1

Query: 136 DSIVGWQLKLYDELQVSPSP 195
D VGW L + DELQ+SP P
Sbjct: 435 DGTVGWILSILDELQLSPQP 454


>sp|Q3TQQ9|CA112_MOUSE Uncharacterized protein C1orf112 homolog
OS=Mus musculus PE=2 SV=2
Length = 903

Score = 30.0 bits (66), Expect = 3.7
Identities = 16/26 (61%), Positives = 18/26 (69%)
Frame = -1

Query: 190 TAKLEAHHTTLVANLLSSRKHWCNGK 113
TAKL AHH TLVA+L+ S C GK
Sbjct: 520 TAKLGAHHVTLVAHLVKS----CPGK 541


>sp|Q42456|ASPR1_ORYSJ Aspartic proteinase oryzasin-1 OS=Oryza
sativa subsp. japonica GN=Os05g0567100 PE=2 SV=2
Length = 509

Score = 29.6 bits (65), Expect = 4.9
Identities = 13/42 (30%), Positives = 21/42 (50%)
Frame = -2

Query: 156 LPTYYRVASTGVMGRPVLSNWHGVSSNLNLAGIVSLEGMDGS 31
+P +Y++ G++ PV S W S+ G + GMD S
Sbjct: 206 VPVWYKMVEQGLVSEPVFSFWFNRHSDEGEGGEIVFGGMDPS 247


>sp|Q96JB2|COG3_HUMAN Conserved oligomeric Golgi complex subunit 3
OS=Homo sapiens GN=COG3 PE=1 SV=3
Length = 828

Score = 28.9 bits (63), Expect = 8.3
Identities = 19/62 (30%), Positives = 28/62 (45%), Gaps = 6/62 (9%)
Frame = +1

Query: 73 EVRTHSMPIGEDGPSHYTSACDSIVGWQLKLYDE------LQVSPSPRLTSVHIPKATLG 234
E+R H + +D H SAC+ + Q KL+ E +VS + S PK TL
Sbjct: 677 EIREHYLDSKKDVDRHLKSACEQFIQQQTKLFVEQLEEFMTKVSALKTMASQGGPKYTLS 736

Query: 235 SK 240
+
Sbjct: 737 QQ 738


tr_hit_id B4EY34
Definition tr|B4EY34|B4EY34_PROMH Putative lipoprotein OS=Proteus mirabilis (strain HI4320)
Align length 44
Score (bit) 36.6
E-value 0.65
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919961|Adiantum capillus-veneris mRNA, clone:
YMU001_000131_C08.
(244 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B4EY34|B4EY34_PROMH Putative lipoprotein OS=Proteus mirabilis... 37 0.65
tr|A6W7N9|A6W7N9_KINRD Sucraseferredoxin family protein OS=Kineo... 33 7.2
tr|A0P045|A0P045_9RHOB Cytochrome d ubiquinol oxidase, subunit I... 33 9.1

>tr|B4EY34|B4EY34_PROMH Putative lipoprotein OS=Proteus mirabilis
(strain HI4320) GN=PMI2666 PE=4 SV=1
Length = 383

Score = 36.6 bits (83), Expect = 0.65
Identities = 16/44 (36%), Positives = 25/44 (56%)
Frame = +1

Query: 91 MPIGEDGPSHYTSACDSIVGWQLKLYDELQVSPSPRLTSVHIPK 222
+P GE P HY + D G+ LK E Q+ P+ ++ ++ IPK
Sbjct: 310 LPFGETTPPHYLTLPDVYAGYSLKQLAEFQLWPTKQMANLPIPK 353


>tr|A6W7N9|A6W7N9_KINRD Sucraseferredoxin family protein
OS=Kineococcus radiotolerans (strain ATCC BAA-149 / DSM
14245 / SRS30216) GN=Krad_1340 PE=4 SV=1
Length = 268

Score = 33.1 bits (74), Expect = 7.2
Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 1/42 (2%)
Frame = -1

Query: 178 EAHHTTLVANLLSSRKHWCNG-KARPLQLAWSEFEPQPGWDC 56
E H L+ RK WC + RP+ A ++ +P+P W+C
Sbjct: 94 EPHGGPLLLVCTHGRKDWCCALRGRPVAAALADLDPEPVWEC 135


>tr|A0P045|A0P045_9RHOB Cytochrome d ubiquinol oxidase, subunit II
OS=Labrenzia aggregata IAM 12614 GN=SIAM614_30121 PE=4
SV=1
Length = 387

Score = 32.7 bits (73), Expect = 9.1
Identities = 13/27 (48%), Positives = 18/27 (66%)
Frame = -3

Query: 116 EGPSSPIGME*VRTSTWLGLFPLREWM 36
+GPS+P+ E RTSTWL + R W+
Sbjct: 247 DGPSNPLYSEVQRTSTWLSAYVARPWI 273