BP919987
Clone id YMU001_000131_F04
Library
Length 417
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000131_F04.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CTCTGGCTGGTTACAAAATACAACACGGGAAAAGCCAGTGCCTCCTAATGGAACAAGGCT
GTCCCCTTCAACAACTGTCGGCCTCACACAGGCGTAGGAGTAGATCTTGCTAAGTCTGAT
CCTTCCCCTTTTCCTCTTGTCCGGCTGCTGCCGTTGGACCGCGTCCATTTTAGGGGACGC
TGTAGTCCTCAGCTGCAACCCAAATAGGCGATTGAGATGTCTGTCTGCTGAAAGCGTGGA
GATGAGCAATATGCAAGCTGTAATTTTGTAAGTAAGATCTGTGCTTGGCAAGCACAAATT
TTGCTTGTGAGGACGACTTGTACAAAATCTGCCTGTGGGAGAGACTGAGGTCGATGATGA
AGGAGAGCTGAGGAGGCTTCAGGGGCCGTTAGAATGATGCGCCGCTGGAAAGGAGCG
■■Homology search results ■■ -
sp_hit_id Q9SGG3
Definition sp|Q9SGG3|ALA5_ARATH Putative phospholipid-transporting ATPase 5 OS=Arabidopsis thaliana
Align length 44
Score (bit) 56.6
E-value 4.0e-08
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919987|Adiantum capillus-veneris mRNA, clone:
YMU001_000131_F04.
(417 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9SGG3|ALA5_ARATH Putative phospholipid-transporting ATPase 5... 57 4e-08
sp|Q9LNQ4|ALA4_ARATH Putative phospholipid-transporting ATPase 4... 55 1e-07
sp|Q9LI83|ALA10_ARATH Putative phospholipid-transporting ATPase ... 50 4e-06
sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9... 47 2e-05
sp|Q9LVK9|ALA7_ARATH Putative phospholipid-transporting ATPase 7... 45 9e-05
sp|Q9SLK6|ALA6_ARATH Putative phospholipid-transporting ATPase 6... 45 1e-04
sp|Q9LK90|ALA8_ARATH Putative phospholipid-transporting ATPase 8... 42 0.001
sp|P57792|ALA12_ARATH Putative phospholipid-transporting ATPase ... 39 0.008
sp|Q9SAF5|ALA11_ARATH Putative phospholipid-transporting ATPase ... 39 0.008
sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor sub... 32 0.99
sp|Q97FX4|SPED_CLOAB S-adenosylmethionine decarboxylase proenzym... 32 1.3
sp|A6MMJ7|RPOC2_DIOEL DNA-directed RNA polymerase subunit beta''... 31 1.7
sp|B0C3J3|FOLD_ACAM1 Bifunctional protein folD OS=Acaryochloris ... 31 2.2
sp|P55773|CCL23_HUMAN C-C motif chemokine 23 OS=Homo sapiens GN=... 30 4.9
sp|Q3V544|RPOC2_ACOCL DNA-directed RNA polymerase subunit beta''... 29 6.4
sp|Q4JYF5|RECF_CORJK DNA replication and repair protein recF OS=... 29 6.4
sp|Q56P11|RPOC2_LACSA DNA-directed RNA polymerase subunit beta''... 29 8.4
sp|B2LMI2|RPOC2_GUIAB DNA-directed RNA polymerase subunit beta''... 29 8.4
sp|Q09MI8|RPOC2_CITSI DNA-directed RNA polymerase subunit beta''... 29 8.4
sp|Q08DY0|CH047_BOVIN Uncharacterized protein C8orf47 homolog OS... 29 8.4

>sp|Q9SGG3|ALA5_ARATH Putative phospholipid-transporting ATPase 5
OS=Arabidopsis thaliana GN=ALA5 PE=2 SV=1
Length = 1228

Score = 56.6 bits (135), Expect = 4e-08
Identities = 23/44 (52%), Positives = 31/44 (70%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQP 4
R R ++RLS +Y++ C+RP +EG P+ G GFSR VFCNQP
Sbjct: 5 RIRSKLRLSLLYTFGCLRPATLEGQDSQPIQGPGFSRTVFCNQP 48


>sp|Q9LNQ4|ALA4_ARATH Putative phospholipid-transporting ATPase 4
OS=Arabidopsis thaliana GN=ALA4 PE=2 SV=2
Length = 1216

Score = 54.7 bits (130), Expect = 1e-07
Identities = 23/44 (52%), Positives = 31/44 (70%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQP 4
R R ++RLS IY++ C+RP+ EG P+ G GFSR V+CNQP
Sbjct: 5 RIRSKLRLSHIYTFGCLRPSADEGQDPHPIQGPGFSRTVYCNQP 48


>sp|Q9LI83|ALA10_ARATH Putative phospholipid-transporting ATPase 10
OS=Arabidopsis thaliana GN=ALA10 PE=1 SV=1
Length = 1202

Score = 50.1 bits (118), Expect = 4e-06
Identities = 24/44 (54%), Positives = 31/44 (70%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQP 4
R+R R+ LSKIYSY C + + E S + GG GFSRVV+CN+P
Sbjct: 6 RRRRRLHLSKIYSYTCGKSSFQEDHSNI--GGPGFSRVVYCNEP 47


>sp|Q9SX33|ALA9_ARATH Putative phospholipid-transporting ATPase 9
OS=Arabidopsis thaliana GN=ALA9 PE=2 SV=1
Length = 1200

Score = 47.4 bits (111), Expect = 2e-05
Identities = 21/46 (45%), Positives = 32/46 (69%)
Frame = -1

Query: 138 KRKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
KR+R R++LSK+Y+ C + + S + GG GFSRVV+CN+P+
Sbjct: 7 KRRRRRLQLSKLYTLTCAQACFKQDHSQI--GGPGFSRVVYCNEPD 50


>sp|Q9LVK9|ALA7_ARATH Putative phospholipid-transporting ATPase 7
OS=Arabidopsis thaliana GN=ALA7 PE=2 SV=2
Length = 1247

Score = 45.4 bits (106), Expect = 9e-05
Identities = 19/45 (42%), Positives = 28/45 (62%)
Frame = -1

Query: 138 KRKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQP 4
+R R RIR S Y++ C+RP +E + G G++R+V CNQP
Sbjct: 4 RRIRSRIRKSHFYTFKCLRPKTLEDQGPHIINGPGYTRIVHCNQP 48


>sp|Q9SLK6|ALA6_ARATH Putative phospholipid-transporting ATPase 6
OS=Arabidopsis thaliana GN=ALA6 PE=1 SV=1
Length = 1244

Score = 44.7 bits (104), Expect = 1e-04
Identities = 18/45 (40%), Positives = 28/45 (62%)
Frame = -1

Query: 138 KRKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQP 4
+R R RIR S Y++ C+RP ++ + G G++R+V CNQP
Sbjct: 4 RRIRSRIRKSHFYTFRCLRPKTLDDQGPHVINGPGYTRIVHCNQP 48


>sp|Q9LK90|ALA8_ARATH Putative phospholipid-transporting ATPase 8
OS=Arabidopsis thaliana GN=ALA8 PE=2 SV=1
Length = 1189

Score = 42.0 bits (97), Expect = 0.001
Identities = 20/46 (43%), Positives = 31/46 (67%)
Frame = -1

Query: 138 KRKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
+R++G ++ SK+YS+ C +P E S + G G+SRVVFCN P+
Sbjct: 4 ERRKG-MKFSKLYSFKCFKPFSREDHSQI--GSRGYSRVVFCNDPD 46


>sp|P57792|ALA12_ARATH Putative phospholipid-transporting ATPase 12
OS=Arabidopsis thaliana GN=ALA12 PE=2 SV=1
Length = 1184

Score = 38.9 bits (89), Expect = 0.008
Identities = 20/50 (40%), Positives = 33/50 (66%), Gaps = 4/50 (8%)
Frame = -1

Query: 138 KRKRGRIRLSKIYSY----ACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
+R++ +I+LSK+++ AC +P + +G +GFSRVVFCNQP+
Sbjct: 7 RRRKRKIQLSKLFTLTGAKACFKPDHSK------IGRSGFSRVVFCNQPD 50


>sp|Q9SAF5|ALA11_ARATH Putative phospholipid-transporting ATPase 11
OS=Arabidopsis thaliana GN=ALA11 PE=2 SV=1
Length = 1203

Score = 38.9 bits (89), Expect = 0.008
Identities = 20/45 (44%), Positives = 28/45 (62%)
Frame = -1

Query: 138 KRKRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQP 4
K +R R+ LS IY++ + E S + GG GFSRVV+CN+P
Sbjct: 3 KCRRRRLHLSNIYAFKGRKSNFQEDHSHI--GGPGFSRVVYCNEP 45


>sp|O14217|TOM70_SCHPO Probable mitochondrial import receptor
subunit tom70 OS=Schizosaccharomyces pombe GN=tom70 PE=1
SV=1
Length = 625

Score = 32.0 bits (71), Expect = 0.99
Identities = 17/38 (44%), Positives = 21/38 (55%)
Frame = -2

Query: 416 APFQRRIILTAPEASSALLHHRPQSLPQADFVQVVLTS 303
A +R + A + SSALL RP LP A F+Q L S
Sbjct: 257 ATVERLLKKVAEKKSSALLKERPPKLPAASFIQTYLDS 294


tr_hit_id A7QCR8
Definition tr|A7QCR8|A7QCR8_VITVI Chromosome undetermined scaffold_79, whole genome shotgun sequence OS=Vitis vinifera
Align length 46
Score (bit) 50.8
E-value 3.0e-05
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919987|Adiantum capillus-veneris mRNA, clone:
YMU001_000131_F04.
(417 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|A7QCR8|A7QCR8_VITVI Chromosome undetermined scaffold_79, whol... 51 3e-05
tr|A7P2Z2|A7P2Z2_VITVI Chromosome chr1 scaffold_5, whole genome ... 47 5e-04
tr|A9SY94|A9SY94_PHYPA Predicted protein OS=Physcomitrella paten... 44 0.003
tr|A7PM91|A7PM91_VITVI Chromosome chr14 scaffold_21, whole genom... 42 0.015
tr|A5BQL2|A5BQL2_VITVI Putative uncharacterized protein OS=Vitis... 42 0.015
tr|B8AWI5|B8AWI5_ORYSI Putative uncharacterized protein OS=Oryza... 41 0.034
tr|A3AZ03|A3AZ03_ORYSJ Putative uncharacterized protein OS=Oryza... 41 0.034
tr|Q5Z656|Q5Z656_ORYSJ Putative ATPase, aminophospholipid transp... 40 0.044
tr|B8B3T2|B8B3T2_ORYSI Putative uncharacterized protein OS=Oryza... 40 0.044
tr|A7PGK9|A7PGK9_VITVI Chromosome chr17 scaffold_16, whole genom... 40 0.058
tr|Q6X971|Q6X971_9RHIZ Reverse transcriptase/maturase OS=Ensifer... 35 1.4
tr|Q92VS5|Q92VS5_RHIME RNA-directed DNA polymerase OS=Rhizobium ... 34 3.2
tr|Q925Z6|Q925Z6_RHIME RNA-directed DNA polymerase (Reverse tran... 34 3.2
tr|Q5IX97|Q5IX97_9RHIZ Reverse transcriptase/maturase OS=Sinorhi... 34 3.2
tr|O69788|O69788_RHIME Reverse transcriptase/maturase OS=Rhizobi... 34 3.2
tr|A8F718|A8F718_THELT Uridine kinase OS=Thermotoga lettingae (s... 34 4.1
tr|A9S0E8|A9S0E8_PHYPA Predicted protein OS=Physcomitrella paten... 34 4.1
tr|Q64PE2|Q64PE2_BACFR Beta-galactosidase OS=Bacteroides fragili... 33 7.1
tr|Q5L981|Q5L981_BACFN Putative glycosyl hydrolase OS=Bacteroide... 33 7.1
tr|Q67VX1|Q67VX1_ORYSJ Putative Potential phospholipid-transport... 33 9.2
tr|A2YD35|A2YD35_ORYSI Putative uncharacterized protein OS=Oryza... 33 9.2

>tr|A7QCR8|A7QCR8_VITVI Chromosome undetermined scaffold_79, whole
genome shotgun sequence OS=Vitis vinifera
GN=GSVIVT00035521001 PE=4 SV=1
Length = 1147

Score = 50.8 bits (120), Expect = 3e-05
Identities = 22/46 (47%), Positives = 35/46 (76%), Gaps = 1/46 (2%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYACVRPTVVEGDSLVPL-GGTGFSRVVFCNQPE 1
RK+G++R SK+YS++C+RP++ + + L G GFSRVVFCN+ +
Sbjct: 7 RKKGKLRWSKLYSFSCLRPSISDPSPVQKLFGQPGFSRVVFCNESQ 52


>tr|A7P2Z2|A7P2Z2_VITVI Chromosome chr1 scaffold_5, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00030242001
PE=4 SV=1
Length = 1128

Score = 47.0 bits (110), Expect = 5e-04
Identities = 23/44 (52%), Positives = 33/44 (75%)
Frame = -1

Query: 132 KRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
+R ++ LSKIY+YAC + T ++GD +G GFSRVVFCN+P+
Sbjct: 5 RRAKLHLSKIYTYACGK-TSLKGDH-EQIGQPGFSRVVFCNEPD 46


>tr|A9SY94|A9SY94_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_189702 PE=4 SV=1
Length = 1251

Score = 44.3 bits (103), Expect = 0.003
Identities = 22/44 (50%), Positives = 32/44 (72%), Gaps = 2/44 (4%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYA-CVRP-TVVEGDSLVPLGGTGFSRVVFCN 10
R + R+R SK+Y++A C+RP + +E + +GG GFSRVVFCN
Sbjct: 3 RGKNRLRFSKLYTWAGCLRPQSPLERQQSMSVGGPGFSRVVFCN 46


>tr|A7PM91|A7PM91_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020729001
PE=4 SV=1
Length = 1135

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/44 (47%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
Frame = -1

Query: 129 RGR-IRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
RGR IR SK+Y+++CVR + E S + G G++RVV+CN P+
Sbjct: 5 RGRGIRFSKLYTFSCVRSSFREDRSQI--GQKGYTRVVYCNDPD 46


>tr|A5BQL2|A5BQL2_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_037830 PE=4 SV=1
Length = 1182

Score = 42.0 bits (97), Expect = 0.015
Identities = 21/44 (47%), Positives = 31/44 (70%), Gaps = 1/44 (2%)
Frame = -1

Query: 129 RGR-IRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
RGR IR SK+Y+++CVR + E S + G G++RVV+CN P+
Sbjct: 5 RGRGIRFSKLYTFSCVRSSFREDRSQI--GQKGYTRVVYCNDPD 46


>tr|B8AWI5|B8AWI5_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_18075 PE=4 SV=1
Length = 1128

Score = 40.8 bits (94), Expect = 0.034
Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
Frame = -1

Query: 120 IRLSKIYSYACVR-PTVVEGDSLVPLGGTGFSRVVFCN 10
+RLS++YS+AC R PT V+ +S +GG GF+RVV N
Sbjct: 1 MRLSRLYSFACGRRPTAVDDESSSRIGGPGFTRVVNAN 38


>tr|A3AZ03|A3AZ03_ORYSJ Putative uncharacterized protein OS=Oryza
sativa subsp. japonica GN=OsJ_016025 PE=4 SV=1
Length = 1189

Score = 40.8 bits (94), Expect = 0.034
Identities = 20/38 (52%), Positives = 28/38 (73%), Gaps = 1/38 (2%)
Frame = -1

Query: 120 IRLSKIYSYACVR-PTVVEGDSLVPLGGTGFSRVVFCN 10
+RLS++YS+AC R PT V+ +S +GG GF+RVV N
Sbjct: 1 MRLSRLYSFACGRRPTAVDDESSSRIGGPGFTRVVNAN 38


>tr|Q5Z656|Q5Z656_ORYSJ Putative ATPase, aminophospholipid
transporter (APLT), class I, type 8A, member 1 OS=Oryza
sativa subsp. japonica GN=P0567G03.5 PE=4 SV=1
Length = 1222

Score = 40.4 bits (93), Expect = 0.044
Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 11/53 (20%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYACVRPT-----------VVEGDSLVPLGGTGFSRVVFCN 10
R+R R+R SK+Y++AC R + EG S V GG GF+RVV CN
Sbjct: 7 RRRDRLRWSKLYTFACFRSSHSNNEAAGGGPAAEGGSAV--GGPGFTRVVHCN 57


>tr|B8B3T2|B8B3T2_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_23406 PE=4 SV=1
Length = 1222

Score = 40.4 bits (93), Expect = 0.044
Identities = 23/53 (43%), Positives = 30/53 (56%), Gaps = 11/53 (20%)
Frame = -1

Query: 135 RKRGRIRLSKIYSYACVRPT-----------VVEGDSLVPLGGTGFSRVVFCN 10
R+R R+R SK+Y++AC R + EG S V GG GF+RVV CN
Sbjct: 7 RRRDRLRWSKLYTFACFRSSHSNNEAAGGGPAAEGGSAV--GGPGFTRVVHCN 57


>tr|A7PGK9|A7PGK9_VITVI Chromosome chr17 scaffold_16, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00017596001
PE=4 SV=1
Length = 744

Score = 40.0 bits (92), Expect = 0.058
Identities = 19/44 (43%), Positives = 28/44 (63%)
Frame = -1

Query: 132 KRGRIRLSKIYSYACVRPTVVEGDSLVPLGGTGFSRVVFCNQPE 1
+R R +I++++C R + SL+ GG GFSR+VFCN PE
Sbjct: 5 RRKRQHFGRIHAFSCGRASFNGEHSLI--GGPGFSRIVFCNDPE 46