BP919996
Clone id YMU001_000131_G03
Library
Length 422
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000131_G03.
Accession
Tissue type prothallium
Developmental stage -
Contig ID
Sequence
CAAAGTGAGCAAACTGTTAAGCTCACAAGCTTCTACAATAGGCAAACAAATTTGACAAAA
TTTTGGTAGAGTCTCCCTTGTAACTGGAGAAAAAACTCAACAGTAAACCGTAAAAGAGAC
AACACAAAATGCCCAAATGGCCAAATCCGGGAATGTTGTCGTCCGGAATCACCTCACAAA
GTCATACAAAGAGCAAGCATGCTCTAGTCGGAGTACCACTCAACGAAATATTGACAAAAC
CTGTCAACTTGTTTGCATAAACAGGCTTCAATGGATGTGCATAAACAAGTGCTCAACTGT
GAGCATCAACCATGCATCCAAAATACTTAGCCATGATGGCTCCACATCTCCACCTCTGTT
CCCACATAGAGTATACATCAACACAAAACTATGTGCCGAGAAACTGCATACGGATGTACC
TT
■■Homology search results ■■ -
sp_hit_id Q55D99
Definition sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dictyostelium discoideum
Align length 61
Score (bit) 32.7
E-value 0.6
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919996|Adiantum capillus-veneris mRNA, clone:
YMU001_000131_G03.
(422 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA OS=Dic... 33 0.60
sp|Q58344|Y934_METJA Uncharacterized polyferredoxin-like protein... 30 3.0
sp|P53129|MON1_YEAST Vacuolar fusion protein MON1 OS=Saccharomyc... 30 3.9
sp|Q5RL51|GSTCD_MOUSE Glutathione S-transferase C-terminal domai... 30 5.0
sp|Q4R6Y8|GSTCD_MACFA Glutathione S-transferase C-terminal domai... 30 5.0
sp|Q8NEC7|GSTCD_HUMAN Glutathione S-transferase C-terminal domai... 30 5.0
sp|Q24025|SOG_DROME Dorsal-ventral patterning protein Sog OS=Dro... 29 6.6
sp|Q6PNC0|DMXL1_MOUSE DmX-like protein 1 OS=Mus musculus GN=Dmxl... 29 6.6
sp|A1RXH8|Y501_THEPD UPF0095 protein Tpen_0501 OS=Thermofilum pe... 29 8.6

>sp|Q55D99|PAKA_DICDI Serine/threonine-protein kinase pakA
OS=Dictyostelium discoideum GN=pakA PE=1 SV=1
Length = 1197

Score = 32.7 bits (73), Expect = 0.60
Identities = 22/61 (36%), Positives = 24/61 (39%)
Frame = +3

Query: 93 KLNSKP*KRQHKMPKWPNPGMLSSGITSQSHTKSKHALVGVPLNEILTKPVNLFA*TGFN 272
KL SK K H K P+ G G + K VG P N VN A TGF
Sbjct: 779 KLFSKEKKDHHSSSKSPSSGSSGGGEVDEKKKKKLSPRVGTPFNVKHDVHVNFNADTGFE 838

Query: 273 G 275
G
Sbjct: 839 G 839


>sp|Q58344|Y934_METJA Uncharacterized polyferredoxin-like protein
MJ0934 OS=Methanocaldococcus jannaschii GN=MJ0934 PE=4
SV=1
Length = 209

Score = 30.4 bits (67), Expect = 3.0
Identities = 11/33 (33%), Positives = 19/33 (57%)
Frame = -3

Query: 102 C*VFSPVTRETLPKFCQICLPIVEACELNSLLT 4
C + +E P+ C++CL +E C L ++LT
Sbjct: 139 CEAIDIINKEINPEKCKLCLSCIEKCPLQAILT 171


>sp|P53129|MON1_YEAST Vacuolar fusion protein MON1 OS=Saccharomyces
cerevisiae GN=MON1 PE=1 SV=1
Length = 644

Score = 30.0 bits (66), Expect = 3.9
Identities = 16/62 (25%), Positives = 28/62 (45%)
Frame = +2

Query: 140 AKSGNVVVRNHLTKSYKEQACSSRSTTQRNIDKTCQLVCINRLQWMCINKCSTVSINHAS 319
+K N +RN+L ST N+D+ C L+C + +N + NH+S
Sbjct: 286 SKRENFDLRNYL-----------ESTDFENLDEICSLICNRMFPDLLLNSLQCLPFNHSS 334

Query: 320 KI 325
++
Sbjct: 335 RL 336


>sp|Q5RL51|GSTCD_MOUSE Glutathione S-transferase C-terminal
domain-containing protein OS=Mus musculus GN=Gstcd PE=2
SV=1
Length = 634

Score = 29.6 bits (65), Expect = 5.0
Identities = 21/89 (23%), Positives = 36/89 (40%), Gaps = 2/89 (2%)
Frame = +2

Query: 155 VVVRNHLTKSYKEQACSSRSTTQRNIDKTCQLVCINRLQWMCINKCSTVSINHASKILSH 334
VV+R+ + KSY+ + KTC C QW + ++I A +
Sbjct: 108 VVLRHIIQKSYEAEPSRKEILELLGFKKTCLKACAEVSQW---TRLCELTIPLAVENFLQ 164

Query: 335 DGSTSPPLFPHRVYINTKLCAE--KLHTD 415
+ S PP P + + +E ++H D
Sbjct: 165 ESSEHPPTIPEEILELERKLSEPVRVHND 193


>sp|Q4R6Y8|GSTCD_MACFA Glutathione S-transferase C-terminal
domain-containing protein OS=Macaca fascicularis
GN=GSTCD PE=2 SV=1
Length = 633

Score = 29.6 bits (65), Expect = 5.0
Identities = 22/89 (24%), Positives = 35/89 (39%), Gaps = 2/89 (2%)
Frame = +2

Query: 155 VVVRNHLTKSYKEQACSSRSTTQRNIDKTCQLVCINRLQWMCINKCSTVSINHASKILSH 334
VV+R+ + KSY+ KTC C QW + ++I A +
Sbjct: 107 VVLRHIIQKSYEADPLKKELLELLGFKKTCLKACAEVSQW---TRLCELTIPLAIENFLR 163

Query: 335 DGSTSPPLFPHRVYINTKLCAE--KLHTD 415
+ S PP P + K +E ++H D
Sbjct: 164 ESSDQPPTIPVEILQLEKKLSEPVRVHND 192


>sp|Q8NEC7|GSTCD_HUMAN Glutathione S-transferase C-terminal
domain-containing protein OS=Homo sapiens GN=GSTCD PE=1
SV=2
Length = 633

Score = 29.6 bits (65), Expect = 5.0
Identities = 22/89 (24%), Positives = 35/89 (39%), Gaps = 2/89 (2%)
Frame = +2

Query: 155 VVVRNHLTKSYKEQACSSRSTTQRNIDKTCQLVCINRLQWMCINKCSTVSINHASKILSH 334
VV+R+ + KSY+ KTC C QW + ++I A +
Sbjct: 107 VVLRHIIQKSYEADPLKKELLELLGFKKTCLKACAEVSQW---TRLCELTIPLAIENFLR 163

Query: 335 DGSTSPPLFPHRVYINTKLCAE--KLHTD 415
+ S PP P + K +E ++H D
Sbjct: 164 ESSDQPPTIPVEILQLEKKLSEPVRVHND 192


>sp|Q24025|SOG_DROME Dorsal-ventral patterning protein Sog
OS=Drosophila melanogaster GN=sog PE=1 SV=1
Length = 1038

Score = 29.3 bits (64), Expect = 6.6
Identities = 19/73 (26%), Positives = 29/73 (39%), Gaps = 5/73 (6%)
Frame = +2

Query: 167 NHL----TKSYKEQACSSRSTTQRNIDKTCQLVCINRLQWMC-INKCSTVSINHASKILS 331
NHL TK + + S R+ +CQ+ R Q C + KC + ++L
Sbjct: 735 NHLVNGETKCFHSGRFYNESEQWRSAQDSCQMCACLRGQSSCEVIKCPALKCKSTEQLLQ 794

Query: 332 HDGSTSPPLFPHR 370
DG P P +
Sbjct: 795 RDGECCPSCVPKK 807


>sp|Q6PNC0|DMXL1_MOUSE DmX-like protein 1 OS=Mus musculus GN=Dmxl1
PE=1 SV=1
Length = 3013

Score = 29.3 bits (64), Expect = 6.6
Identities = 21/48 (43%), Positives = 24/48 (50%), Gaps = 1/48 (2%)
Frame = +2

Query: 200 CSSRSTTQ-RNIDKTCQLVCINRLQWMCINKCSTVSINHASKILSHDG 340
C+SR T+ N DKT +N WMCI C T S H K S DG
Sbjct: 136 CNSRKQTEDENPDKTD----LNFGNWMCIWHCKTASQVHLMK-FSPDG 178


>sp|A1RXH8|Y501_THEPD UPF0095 protein Tpen_0501 OS=Thermofilum
pendens (strain Hrk 5) GN=Tpen_0501 PE=3 SV=1
Length = 426

Score = 28.9 bits (63), Expect = 8.6
Identities = 11/34 (32%), Positives = 22/34 (64%)
Frame = +3

Query: 150 GMLSSGITSQSHTKSKHALVGVPLNEILTKPVNL 251
G+++ + ++TK +L+GV + EI+ KP N+
Sbjct: 364 GIITQRLVDVAYTKGLKSLIGVRIGEIIRKPDNI 397


tr_hit_id B8MFE0
Definition tr|B8MFE0|B8MFE0_9EURO Multicopper oxidase, putative OS=Talaromyces stipitatus ATCC 10500
Align length 79
Score (bit) 33.9
E-value 4.1
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP919996|Adiantum capillus-veneris mRNA, clone:
YMU001_000131_G03.
(422 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8MFE0|B8MFE0_9EURO Multicopper oxidase, putative OS=Talaromy... 34 4.1
tr|B0VZQ9|B0VZQ9_CULQU Zinc finger protein 60 OS=Culex quinquefa... 33 5.4
tr|Q7RE75|Q7RE75_PLAYO Putative uncharacterized protein PY05192 ... 33 7.0
tr|B3N6J5|B3N6J5_DROER GG24133 OS=Drosophila erecta GN=GG24133 P... 33 7.0

>tr|B8MFE0|B8MFE0_9EURO Multicopper oxidase, putative OS=Talaromyces
stipitatus ATCC 10500 GN=TSTA_017490 PE=4 SV=1
Length = 558

Score = 33.9 bits (76), Expect = 4.1
Identities = 21/79 (26%), Positives = 36/79 (45%)
Frame = +2

Query: 128 NAQMAKSGNVVVRNHLTKSYKEQACSSRSTTQRNIDKTCQLVCINRLQWMCINKCSTVSI 307
N ++ G V LT+ + +A + TT ++I+ T + W N T +
Sbjct: 355 NYNISSQGCVEDSLELTEPFFPEALPTEITTYQDINITFGANATGAMVWFANNISFTANY 414

Query: 308 NHASKILSHDGSTSPPLFP 364
NH +L+ +G+TS P P
Sbjct: 415 NHPLLLLAKEGNTSYPYDP 433


>tr|B0VZQ9|B0VZQ9_CULQU Zinc finger protein 60 OS=Culex
quinquefasciatus GN=CpipJ_CPIJ000178 PE=4 SV=1
Length = 528

Score = 33.5 bits (75), Expect = 5.4
Identities = 20/83 (24%), Positives = 34/83 (40%), Gaps = 5/83 (6%)
Frame = +2

Query: 161 VRNHLTKSYKEQACSSRSTTQRNIDKTCQLVC-----INRLQWMCINKCSTVSINHASKI 325
+R H+ + + C S+ Q N+DK Q V ++ + C CS V ++H I
Sbjct: 318 LRAHMQRHKGQVRCKVCSSAQHNMDKLYQHVTKFHRDTRKMTYDCCPNCSEVHLSHQQMI 377

Query: 326 LSHDGSTSPPLFPHRVYINTKLC 394
+ PP R + +C
Sbjct: 378 EHKESCLLPPSLYGRFRLECHIC 400


>tr|Q7RE75|Q7RE75_PLAYO Putative uncharacterized protein PY05192
OS=Plasmodium yoelii yoelii GN=PY05192 PE=4 SV=1
Length = 677

Score = 33.1 bits (74), Expect = 7.0
Identities = 19/55 (34%), Positives = 29/55 (52%), Gaps = 6/55 (10%)
Frame = +2

Query: 209 RSTTQRNIDKTCQL------VCINRLQWMCINKCSTVSINHASKILSHDGSTSPP 355
++TTQ N+D T ++ VC N + +C N S+V N+ S S DG + P
Sbjct: 508 QTTTQHNLDTTPKIGNNVSSVCSNNVSSVCSNNVSSVCSNNVSSGDSSDGKGAGP 562


>tr|B3N6J5|B3N6J5_DROER GG24133 OS=Drosophila erecta GN=GG24133 PE=4
SV=1
Length = 612

Score = 33.1 bits (74), Expect = 7.0
Identities = 19/67 (28%), Positives = 31/67 (46%), Gaps = 3/67 (4%)
Frame = +2

Query: 224 RNIDKTCQLVCINRLQWMCINKCSTVSINHAS---KILSHDGSTSPPLFPHRVYINTKLC 394
R K C ++ L W+ + C T ++ S +L+ +TSPP F H NT +
Sbjct: 255 RTFGKYCDVIKDANLNWLEWSVCFTKEFHNRSAVLNLLASSAATSPPHFTHYNIHNTNVN 314

Query: 395 AEKLHTD 415
+ HT+
Sbjct: 315 GHRGHTN 321