BP920022
Clone id YMU001_000132_B07
Library
Length 496
Definition Adiantum capillus-veneris mRNA. clone: YMU001_000132_B07.
Accession
Tissue type prothallium
Developmental stage -
Contig ID -
Sequence
CAAATGCCTCAGTTAGCAAGGGGCCATGGGCATGTCAGAAGAAAACTGACATTTAACGAC
AATAACGAGGGAAATGACTTGCGCAGACCTTCGTTTATCTTGGAAAGAGCTTCCCACGAA
TCAATTCTGTGACGATGGAAACCTCCAGGTAAGTGTTGCTGCTCAATCCCATGAAATTAA
GATCTCCCTTCATAGTTCAAGGTTTTCACGTCAAAAGCACGAAGGAACCAAGGAGCCTGT
GTATGTCGATGGTCACATCTCTATCAAAAACGAAGGAAGATCACAATCTGCCCAAAATGG
CAAGGTCTCATGTGAGTTTAACGAATTCCAAGACCGTGCTGCTCTTCTACACTTGATAAA
GACCTGTGGCAAACGAAAGGACCTGAACAAAGGCAGCAGAATACATGCTGATATCATTCG
AAGAGGTTTGCTTGAGAGTGATATCACGTTTGGCAATGCACTCCTCAGTATGTATGCCAA
TTGTGGCACTCTCGTG
■■Homology search results ■■ -
sp_hit_id Q9LUC2
Definition sp|Q9LUC2|PP231_ARATH Pentatricopeptide repeat-containing protein At3g14730 OS=Arabidopsis thaliana
Align length 57
Score (bit) 45.4
E-value 0.0001
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920022|Adiantum capillus-veneris mRNA, clone:
YMU001_000132_B07.
(496 letters)

Database: uniprot_sprot.fasta
412,525 sequences; 148,809,765 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

sp|Q9LUC2|PP231_ARATH Pentatricopeptide repeat-containing protei... 45 1e-04
sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protei... 44 4e-04
sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protei... 44 5e-04
sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protei... 43 0.001
sp|Q9FNN9|PP370_ARATH Putative pentatricopeptide repeat-containi... 43 0.001
sp|Q9FFN1|PP363_ARATH Pentatricopeptide repeat-containing protei... 42 0.001
sp|Q9SII7|PP159_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|Q9FXH1|PPR52_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|O65543|PP343_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|Q0WNP3|PP319_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|Q9LIQ7|PP252_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|Q680H3|PP170_ARATH Pentatricopeptide repeat-containing protei... 42 0.002
sp|Q9SVH0|PP329_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q7Y211|PP285_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q9LS72|PP261_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q9SS97|PP205_ARATH Putative pentatricopeptide repeat-containi... 41 0.003
sp|Q9M2Y4|PP276_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q9LRV2|PP256_ARATH Pentatricopeptide repeat-containing protei... 41 0.003
sp|Q0WVU0|PP278_ARATH Pentatricopeptide repeat-containing protei... 40 0.006
sp|O80647|PP195_ARATH Pentatricopeptide repeat-containing protei... 40 0.006
sp|Q9FXA9|PPR83_ARATH Putative pentatricopeptide repeat-containi... 40 0.008
sp|Q9FIB2|PP373_ARATH Putative pentatricopeptide repeat-containi... 39 0.010
sp|Q9SB36|PP337_ARATH Pentatricopeptide repeat-containing protei... 39 0.010
sp|Q9LJJ1|PP259_ARATH Putative pentatricopeptide repeat-containi... 39 0.010
sp|Q9SIT7|PP151_ARATH Pentatricopeptide repeat-containing protei... 39 0.010
sp|O49287|PP127_ARATH Putative pentatricopeptide repeat-containi... 39 0.010
sp|Q9FLZ9|PP405_ARATH Pentatricopeptide repeat-containing protei... 39 0.013
sp|Q84MA3|PP345_ARATH Pentatricopeptide repeat-containing protei... 39 0.013
sp|Q9SVP7|PP307_ARATH Pentatricopeptide repeat-containing protei... 39 0.013

>sp|Q9LUC2|PP231_ARATH Pentatricopeptide repeat-containing protein
At3g14730 OS=Arabidopsis thaliana GN=PCMP-E31 PE=2 SV=1
Length = 653

Score = 45.4 bits (106), Expect = 1e-04
Identities = 19/57 (33%), Positives = 33/57 (57%)
Frame = +2

Query: 323 EFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
E + A + ++ C +RKD G +IH ++R+G L+ G +L++MYA CG +
Sbjct: 56 EHHNVATCIATLQRCAQRKDYVSGQQIHGFMVRKGFLDDSPRAGTSLVNMYAKCGLM 112



Score = 37.7 bits (86), Expect = 0.029
Identities = 21/57 (36%), Positives = 29/57 (50%), Gaps = 3/57 (5%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLL---ESDITFGNALLSMYANCGTL 493
D L ++ TCG+ L +G IH +I GLL S+ N+L+ MY CG L
Sbjct: 362 DIVTLTTVLPTCGRLASLRQGREIHGYMIVSGLLNRKSSNEFIHNSLMDMYVKCGDL 418


>sp|Q9C6T2|PPR68_ARATH Pentatricopeptide repeat-containing protein
At1g31920 OS=Arabidopsis thaliana GN=PCMP-H11 PE=2 SV=1
Length = 606

Score = 43.9 bits (102), Expect = 4e-04
Identities = 27/107 (25%), Positives = 49/107 (45%), Gaps = 6/107 (5%)
Frame = +2

Query: 191 HSSRFSRQKHEGTKEPVYVDGHISIKNEGRSQSAQNGKVSCEFNEFQDRA------ALLH 352
+S ++ G +P D + I+ S + + C +NE R
Sbjct: 80 NSMNYAASIFRGIDDPCTFDFNTMIRGYVNVMSFE--EALCFYNEMMQRGNEPDNFTYPC 137

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
L+K C + K + +G +IH + + G LE+D+ N+L++MY CG +
Sbjct: 138 LLKACTRLKSIREGKQIHGQVFKLG-LEADVFVQNSLINMYGRCGEM 183



Score = 30.8 bits (68), Expect = 3.6
Identities = 17/60 (28%), Positives = 28/60 (46%)
Frame = +2

Query: 314 EFNEFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
E N + + ++ + C LN G IH ++R + E +I +L+ MY CG L
Sbjct: 227 ETNLKAEESGMVSALLACANTGALNLGMSIHGFLLRN-ISELNIIVQTSLVDMYVKCGCL 285


>sp|Q9SS83|PP220_ARATH Pentatricopeptide repeat-containing protein
At3g09040, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E88 PE=2 SV=1
Length = 1028

Score = 43.5 bits (101), Expect = 5e-04
Identities = 21/47 (44%), Positives = 30/47 (63%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
L+ TC DL GS+ H+ II++ L ++ + GNAL+ MYA CG L
Sbjct: 434 LLSTCAASHDLEMGSQFHSIIIKKKLAKN-LFVGNALVDMYAKCGAL 479



Score = 35.4 bits (80), Expect = 0.15
Identities = 17/54 (31%), Positives = 30/54 (55%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D A L +K C L +G ++H ++ GL + D+ G++L+ MY+ CG +
Sbjct: 528 DGACLASTLKACTHVHGLYQGKQVHCLSVKCGL-DRDLHTGSSLIDMYSKCGII 580



Score = 35.0 bits (79), Expect = 0.19
Identities = 17/53 (32%), Positives = 29/53 (54%)
Frame = +2

Query: 326 FQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANC 484
F ++ ++ TC + ++ G +IH +I+ G LE + G AL+ MYA C
Sbjct: 157 FPNKFTFSIVLSTCARETNVEFGRQIHCSMIKMG-LERNSYCGGALVDMYAKC 208



Score = 32.3 bits (72), Expect = 1.2
Identities = 14/43 (32%), Positives = 22/43 (51%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYAN 481
+++ C K + L G++ H I +RG G +LL MY N
Sbjct: 635 IVEACHKPESLTLGTQFHGQITKRGFSSEGEYLGISLLGMYMN 677



Score = 32.0 bits (71), Expect = 1.6
Identities = 16/54 (29%), Positives = 27/54 (50%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D+A + +++ C L +G IH+ I ++T N L+ MYA CG +
Sbjct: 731 DQATFVTVLRVCSVLSSLREGRAIHSLIFHLAHDLDELT-SNTLIDMYAKCGDM 783


>sp|Q9M9E2|PPR45_ARATH Pentatricopeptide repeat-containing protein
At1g15510, chloroplastic OS=Arabidopsis thaliana
GN=PCMP-H73 PE=2 SV=1
Length = 866

Score = 42.7 bits (99), Expect = 0.001
Identities = 19/45 (42%), Positives = 28/45 (62%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCG 487
+++TCG DL +G +H ++R G E DI NAL++MY CG
Sbjct: 202 VLRTCGGIPDLARGKEVHVHVVRYGY-ELDIDVVNALITMYVKCG 245



Score = 32.3 bits (72), Expect = 1.2
Identities = 17/46 (36%), Positives = 23/46 (50%)
Frame = +2

Query: 356 IKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
+ C + L G IHA ++R G+ D NALL MY CG +
Sbjct: 505 LAACARIGALMCGKEIHAHVLRTGVGLDDF-LPNALLDMYVRCGRM 549



Score = 30.0 bits (66), Expect = 6.1
Identities = 19/53 (35%), Positives = 24/53 (45%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGT 490
D L +I C D G IHA +I G DI+ N+L MY N G+
Sbjct: 296 DLMTLTSVISACELLGDRRLGRDIHAYVITTGFAV-DISVCNSLTQMYLNAGS 347


>sp|Q9FNN9|PP370_ARATH Putative pentatricopeptide repeat-containing
protein At5g08490 OS=Arabidopsis thaliana GN=PCMP-E32
PE=3 SV=1
Length = 849

Score = 42.7 bits (99), Expect = 0.001
Identities = 19/52 (36%), Positives = 28/52 (53%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCG 487
D ++ ++ C + DL G IH+ I+R L D + GNAL+S YA G
Sbjct: 329 DSVTIISILPVCAQLTDLASGKEIHSYILRHSYLLEDTSVGNALISFYARFG 380



Score = 38.9 bits (89), Expect = 0.013
Identities = 20/56 (35%), Positives = 29/56 (51%), Gaps = 2/56 (3%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLL--ESDITFGNALLSMYANCGTL 493
D +L L+K C + + K +H ++ GLL E + GNALL YA CG +
Sbjct: 431 DSVTILSLLKFCINVQGIGKVKEVHGYSVKAGLLHDEEEPKLGNALLDAYAKCGNV 486



Score = 35.0 bits (79), Expect = 0.19
Identities = 19/45 (42%), Positives = 26/45 (57%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCG 487
++ C + D G +H+ II+ GL E D GNAL+SMYA G
Sbjct: 128 VLPLCVRLGDSYNGKSMHSYIIKAGL-EKDTLVGNALVSMYAKFG 171



Score = 34.7 bits (78), Expect = 0.25
Identities = 22/65 (33%), Positives = 31/65 (47%), Gaps = 6/65 (9%)
Frame = +2

Query: 317 FNEFQDRA------ALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYA 478
F E Q R +++L+ C + L+ + H IIR GL DI LL +YA
Sbjct: 556 FREIQARGMRPNTVTIMNLLPVCAQLASLHLVRQCHGYIIRGGL--GDIRLKGTLLDVYA 613

Query: 479 NCGTL 493
CG+L
Sbjct: 614 KCGSL 618


>sp|Q9FFN1|PP363_ARATH Pentatricopeptide repeat-containing protein
At5g03800 OS=Arabidopsis thaliana GN=EMB175 PE=2 SV=1
Length = 896

Score = 42.4 bits (98), Expect = 0.001
Identities = 22/58 (37%), Positives = 31/58 (53%)
Frame = +2

Query: 311 CEFNEFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANC 484
CE F D +L ++ CG G +IH ++ G SDI+ GN+L+SMYA C
Sbjct: 513 CEQKLFLDEVSLTLILAVCGTLGFREMGYQIHCYALKAGYF-SDISLGNSLISMYAKC 569


>sp|Q9SII7|PP159_ARATH Pentatricopeptide repeat-containing protein
At2g17210 OS=Arabidopsis thaliana GN=PCMP-E77 PE=2 SV=2
Length = 736

Score = 42.0 bits (97), Expect = 0.002
Identities = 21/77 (27%), Positives = 36/77 (46%)
Frame = +2

Query: 263 IKNEGRSQSAQNGKVSCEFNEFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESD 442
+ + GRS A + + C + + ++ L+ C DL H IRR L +D
Sbjct: 425 LAHAGRSDEAIS--IFCHMRDTPNAITVISLLNACSVSADLRTSKWAHGIAIRRSLAIND 482

Query: 443 ITFGNALLSMYANCGTL 493
I+ G +++ YA CG +
Sbjct: 483 ISVGTSIVDAYAKCGAI 499



Score = 36.2 bits (82), Expect = 0.086
Identities = 19/57 (33%), Positives = 29/57 (50%)
Frame = +2

Query: 323 EFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
+F D + K C K L +G I A +++RG ES ++ GN++ Y CG L
Sbjct: 43 QFNDPFVFPIVFKACAKLSWLFQGRCIQASLLKRG-FESFVSVGNSIADFYMKCGDL 98



Score = 33.5 bits (75), Expect = 0.56
Identities = 15/49 (30%), Positives = 27/49 (55%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYA 478
D + ++K C +D++ G +H IRRG +D+ N+L+ MY+
Sbjct: 246 DCVTVTSVLKACTVMEDIDVGRSVHGFSIRRGFDLADVFVCNSLIDMYS 294


>sp|Q9FXH1|PPR52_ARATH Pentatricopeptide repeat-containing protein
At1g19720 OS=Arabidopsis thaliana GN=DYW7 PE=2 SV=1
Length = 894

Score = 41.6 bits (96), Expect = 0.002
Identities = 16/50 (32%), Positives = 31/50 (62%)
Frame = +2

Query: 344 LLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
++ + C K +N+GS +H+ ++ G ++ D+ GN+L+ MY+ CG L
Sbjct: 355 IMSAVSACSCLKVINQGSEVHSIAVKMGFID-DVLVGNSLVDMYSKCGKL 403



Score = 33.1 bits (74), Expect = 0.73
Identities = 15/47 (31%), Positives = 28/47 (59%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
+++ C D+ G IH+ +I+ G+ S + N++L++YA CG L
Sbjct: 187 ILQGCANCGDVEAGKVIHSVVIKLGM-SSCLRVSNSILAVYAKCGEL 232



Score = 32.0 bits (71), Expect = 1.6
Identities = 20/54 (37%), Positives = 29/54 (53%), Gaps = 1/54 (1%)
Frame = +2

Query: 335 RAALLHLIKTCGKRKDLNKGSRIHADIIRRGLL-ESDITFGNALLSMYANCGTL 493
R+ L L+++C ++ G +HA R GL E D+ LLSMYA CG +
Sbjct: 81 RSTYLKLLESCIDSGSIHLGRILHA---RFGLFTEPDVFVETKLLSMYAKCGCI 131


>sp|Q9LXF2|PP385_ARATH Pentatricopeptide repeat-containing protein
At5g15300 OS=Arabidopsis thaliana GN=PCMP-E40 PE=2 SV=2
Length = 548

Score = 41.6 bits (96), Expect = 0.002
Identities = 22/61 (36%), Positives = 30/61 (49%), Gaps = 4/61 (6%)
Frame = +2

Query: 323 EFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFG----NALLSMYANCGT 490
E D +L L+ C DL G R+H I+ + S I G NAL+ MYA CG+
Sbjct: 271 EHPDVVTILSLLSACAVLGDLETGKRLHIYILETASVSSSIYVGTPIWNALIDMYAKCGS 330

Query: 491 L 493
+
Sbjct: 331 I 331



Score = 36.6 bits (83), Expect = 0.066
Identities = 22/79 (27%), Positives = 37/79 (46%), Gaps = 6/79 (7%)
Frame = +2

Query: 275 GRSQSAQNGKVSCEFNEFQ------DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLE 436
G +QS + K + E + DR ++K C K + + G H ++R G +
Sbjct: 86 GSAQSMKPEKTVSLYTEMEKRGVSPDRYTFTFVLKACSKLEWRSNGFAFHGKVVRHGFVL 145

Query: 437 SDITFGNALLSMYANCGTL 493
++ NAL+ +ANCG L
Sbjct: 146 NEYV-KNALILFHANCGDL 163


>sp|O65543|PP343_ARATH Pentatricopeptide repeat-containing protein
At4g31070, mitochondrial OS=Arabidopsis thaliana
GN=PCMP-E7 PE=2 SV=2
Length = 624

Score = 41.6 bits (96), Expect = 0.002
Identities = 33/125 (26%), Positives = 60/125 (48%), Gaps = 2/125 (1%)
Frame = +2

Query: 125 FCDDGNLQVS-VAAQSHEIK-ISLHSSRFSRQKHEGTKEPVYVDGHISIKNEGRSQSAQN 298
+C GN+ +S V ++ +++ + + SS S G V +++ N+ R + +
Sbjct: 308 YCRCGNVSLSRVLFETSKVRDVVMWSSMISGYAETGDCSEV-----MNLLNQMRKEGIEA 362

Query: 299 GKVSCEFNEFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYA 478
V+ LL ++ C L+ S +H+ I++ G + S I GNAL+ MYA
Sbjct: 363 NSVT-----------LLAIVSACTNSTLLSFASTVHSQILKCGFM-SHILLGNALIDMYA 410

Query: 479 NCGTL 493
CG+L
Sbjct: 411 KCGSL 415


tr_hit_id B8LQA8
Definition tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea sitchensis
Align length 54
Score (bit) 58.2
E-value 2.0e-07
Report
BLASTX 2.2.19 [Nov-02-2008]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer,
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997),
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs", Nucleic Acids Res. 25:3389-3402.

Query= BP920022|Adiantum capillus-veneris mRNA, clone:
YMU001_000132_B07.
(496 letters)

Database: uniprot_trembl.fasta
7,341,751 sequences; 2,391,615,440 total letters

Searching..................................................done



Score E
Sequences producing significant alignments: (bits) Value

tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea... 58 2e-07
tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella paten... 52 1e-05
tr|A7PMY8|A7PMY8_VITVI Chromosome chr14 scaffold_21, whole genom... 51 3e-05
tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella paten... 49 1e-04
tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea... 47 5e-04
tr|A7QB76|A7QB76_VITVI Chromosome chr4 scaffold_73, whole genome... 47 5e-04
tr|A5AEG7|A5AEG7_VITVI Putative uncharacterized protein OS=Vitis... 47 5e-04
tr|Q2R8W9|Q2R8W9_ORYSJ Os11g0213500 protein OS=Oryza sativa subs... 47 7e-04
tr|A5BKA9|A5BKA9_VITVI Putative uncharacterized protein OS=Vitis... 47 7e-04
tr|A2ZCL7|A2ZCL7_ORYSI Putative uncharacterized protein OS=Oryza... 47 7e-04
tr|Q5W963|Q5W963_PHYPA PPR1106-17 OS=Physcomitrella patens PE=2 ... 46 9e-04
tr|A7QK10|A7QK10_VITVI Chromosome undetermined scaffold_109, who... 46 9e-04
tr|A9RLJ0|A9RLJ0_PHYPA Predicted protein OS=Physcomitrella paten... 46 0.001
tr|A7QMH4|A7QMH4_VITVI Chromosome chr19 scaffold_126, whole geno... 45 0.001
tr|A7P7N4|A7P7N4_VITVI Chromosome chr9 scaffold_7, whole genome ... 45 0.001
tr|Q5W965|Q5W965_PHYPA PPR868-14 OS=Physcomitrella patens PE=2 SV=1 45 0.002
tr|A9SDQ1|A9SDQ1_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|A2WYV9|A2WYV9_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.002
tr|Q84M45|Q84M45_ORYSJ Putative pentatricopeptide repeat contain... 45 0.002
tr|Q10BR5|Q10BR5_ORYSJ Calreticulin family protein, expressed (P... 45 0.002
tr|B8ALT6|B8ALT6_ORYSI Putative uncharacterized protein OS=Oryza... 45 0.002
tr|A9T938|A9T938_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|A9T5P5|A9T5P5_PHYPA Predicted protein OS=Physcomitrella paten... 45 0.002
tr|A5AIJ1|A5AIJ1_VITVI Putative uncharacterized protein OS=Vitis... 45 0.002
tr|Q2QUQ5|Q2QUQ5_ORYSJ Pentatricopeptide, putative, expressed OS... 44 0.003
tr|A7R1R7|A7R1R7_VITVI Chromosome chr4 scaffold_373, whole genom... 44 0.003
tr|A7QPF6|A7QPF6_VITVI Chromosome chr18 scaffold_137, whole geno... 44 0.003
tr|A7QI85|A7QI85_VITVI Chromosome chr17 scaffold_101, whole geno... 44 0.003
tr|A5B564|A5B564_VITVI Putative uncharacterized protein OS=Vitis... 44 0.003
tr|A3CGD4|A3CGD4_ORYSJ Putative uncharacterized protein OS=Oryza... 44 0.003

>tr|B8LQA8|B8LQA8_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 795

Score = 58.2 bits (139), Expect = 2e-07
Identities = 27/54 (50%), Positives = 34/54 (62%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D+ L +IK CG + DL G ++H DII RG ESD+ G AL SMY CG+L
Sbjct: 119 DKLVFLSVIKACGSQSDLQAGRKVHEDIIARG-FESDVIVGTALASMYTKCGSL 171



Score = 42.7 bits (99), Expect = 0.009
Identities = 26/79 (32%), Positives = 41/79 (51%), Gaps = 6/79 (7%)
Frame = +2

Query: 275 GRSQSAQNGKVSCEFNEFQ------DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLE 436
G SQ+ Q + F+E Q + + L+ ++ C L +G +IH IR G+ E
Sbjct: 195 GYSQNGQPYEALALFSEMQVNGIKPNSSTLVSVMPVCAHLLALEQGKQIHCYAIRSGI-E 253

Query: 437 SDITFGNALLSMYANCGTL 493
SD+ N L++MYA CG +
Sbjct: 254 SDVLVVNGLVNMYAKCGNV 272



Score = 42.4 bits (98), Expect = 0.012
Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 6/79 (7%)
Frame = +2

Query: 275 GRSQSAQNGKVSCEFNEFQDRA------ALLHLIKTCGKRKDLNKGSRIHADIIRRGLLE 436
G S ++Q+ + FN Q R ++ ++ C L +G +IH IR G
Sbjct: 296 GYSLNSQHHEALAFFNRMQVRGIKPNSITMVSVLPACAHLFALEQGQQIHGYAIRSGFES 355

Query: 437 SDITFGNALLSMYANCGTL 493
+D+ GNAL++MYA CG +
Sbjct: 356 NDVV-GNALVNMYAKCGNV 373



Score = 37.4 bits (85), Expect = 0.40
Identities = 18/54 (33%), Positives = 29/54 (53%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D A++ ++ C L +G +IH IR G ES++ G L+ +YA CG +
Sbjct: 422 DSFAIVSVLPACAHFLALEQGKQIHGYTIRSGF-ESNVVVGTGLVDIYAKCGNV 474


>tr|A9U2Q7|A9U2Q7_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_154890 PE=4 SV=1
Length = 922

Score = 52.4 bits (124), Expect = 1e-05
Identities = 32/99 (32%), Positives = 50/99 (50%), Gaps = 3/99 (3%)
Frame = +2

Query: 206 SRQKHEGTKEPVYVDGHISIKNEGRSQSAQNGKVSCEFNE--FQ-DRAALLHLIKTCGKR 376
+RQ + + P V + I G + ++ + + FQ DR L+ C R
Sbjct: 307 ARQVFDNLRSPNRVSWNAMIAGYGEGFMEEAFRLFRDMQQKGFQPDRFTYASLLAICADR 366

Query: 377 KDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
DLN+G +H+ I+R E+D+T AL+SMYA CG+L
Sbjct: 367 ADLNRGKELHSQIVRTAW-EADVTVATALISMYAKCGSL 404



Score = 45.4 bits (106), Expect = 0.001
Identities = 21/54 (38%), Positives = 34/54 (62%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
++ + ++ C DL +G ++HA I + GL E ++ GNAL+SMYA CG+L
Sbjct: 252 NKVSFASILGACTNPNDLEQGLKLHAYIKQAGL-EQEVLVGNALISMYARCGSL 304



Score = 40.8 bits (94), Expect = 0.036
Identities = 19/54 (35%), Positives = 30/54 (55%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D + L+ +C +D +G IH I + G+L +++ NAL+SMY CG L
Sbjct: 453 DHVTFITLLNSCTSPEDFERGRYIHGKIDQWGMLSNNLV-ANALISMYGRCGKL 505



Score = 38.1 bits (87), Expect = 0.23
Identities = 17/46 (36%), Positives = 28/46 (60%)
Frame = +2

Query: 356 IKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
++ C + K L +G ++H D +R E DI N L+SMY+ CG++
Sbjct: 58 LQECVQAKSLAEGKKVH-DHMRSAQFEPDIYLNNMLISMYSKCGSI 102



Score = 37.4 bits (85), Expect = 0.40
Identities = 17/54 (31%), Positives = 31/54 (57%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D+ +++++ +DL+ G +IH + + GL E DI L+ MY+ CG+L
Sbjct: 554 DKYTFINVLRAIANLEDLDAGRKIHGLVEKAGL-EKDIRILTTLIKMYSKCGSL 606



Score = 35.8 bits (81), Expect = 1.2
Identities = 17/51 (33%), Positives = 28/51 (54%)
Frame = +2

Query: 341 ALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
+ + ++ C L G +IH+ I + G ESD+ AL++MY CG+L
Sbjct: 154 SFISILSACQTPIVLEFGEQIHSHITKAGY-ESDVNVSTALINMYCKCGSL 203


>tr|A7PMY8|A7PMY8_VITVI Chromosome chr14 scaffold_21, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00020997001
PE=4 SV=1
Length = 515

Score = 50.8 bits (120), Expect = 3e-05
Identities = 23/58 (39%), Positives = 31/58 (53%)
Frame = +2

Query: 323 EFQDRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTLV 496
E D +L L+ C DL+ G RIH I G + + GNAL+ MYA CG++V
Sbjct: 237 ELPDEVTMLSLLSACTDLGDLDAGQRIHCCISEMGFRDLSVLLGNALIDMYAKCGSIV 294


>tr|A9SQ58|A9SQ58_PHYPA Predicted protein OS=Physcomitrella patens
subsp. patens GN=PHYPADRAFT_133419 PE=4 SV=1
Length = 505

Score = 48.9 bits (115), Expect = 1e-04
Identities = 21/54 (38%), Positives = 30/54 (55%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
DR ++ C + L KG ++H D++R G+ DI GN L+ MYA CG L
Sbjct: 149 DRITFTTILNVCSTLRSLEKGMKVHQDMVRGGI-RPDIILGNTLIDMYAKCGNL 201



Score = 40.4 bits (93), Expect = 0.047
Identities = 18/54 (33%), Positives = 28/54 (51%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D+ A ++ C D+ KG +H I++ G+ +DI N L+ MY CG L
Sbjct: 348 DKRAYTTILNVCAMLGDIEKGKAVHGHIVQSGIA-TDIITENGLIDMYVKCGRL 400



Score = 37.0 bits (84), Expect = 0.52
Identities = 18/52 (34%), Positives = 30/52 (57%)
Frame = +2

Query: 341 ALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTLV 496
A + L++ C KDL +G +HA + + + + NAL++MY CG+LV
Sbjct: 51 AYVCLLRRCTHMKDLAEGKYVHAHMAKSDFVPTTFVL-NALVNMYMKCGSLV 101



Score = 36.6 bits (83), Expect = 0.68
Identities = 26/77 (33%), Positives = 34/77 (44%), Gaps = 6/77 (7%)
Frame = +2

Query: 272 EGRSQSAQNGKVSCEFNEFQ------DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLL 433
EG Q Q + FN+ Q + L ++K C L G RIHA I+ GL
Sbjct: 423 EGWVQHRQYQEALDTFNDMQLEGVMPNTVTFLGVLKACAGMGSLVDGKRIHARIVEAGLA 482

Query: 434 ESDITFGNALLSMYANC 484
E + +AL MYA C
Sbjct: 483 E-NAHIRHALADMYAKC 498


>tr|B8LKN6|B8LKN6_PICSI Putative uncharacterized protein OS=Picea
sitchensis PE=2 SV=1
Length = 394

Score = 47.0 bits (110), Expect = 5e-04
Identities = 22/47 (46%), Positives = 30/47 (63%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
++ C + DL +G IH IIRRG L+ I GNAL+ MYA CG++
Sbjct: 220 VLPACAQLSDLQQGKEIHGYIIRRG-LDLGIVVGNALIDMYAKCGSI 265



Score = 35.4 bits (80), Expect = 1.5
Identities = 15/47 (31%), Positives = 29/47 (61%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
++ C + L++G I+ +II +G E D+ NAL++M+ CG++
Sbjct: 119 VLNACARLASLSEGKLIYDEIISKGC-EMDVIVENALINMFMKCGSI 164



Score = 33.1 bits (74), Expect = 7.5
Identities = 16/40 (40%), Positives = 23/40 (57%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSM 472
++ C L +G RIH D++ R +SDI GNAL+ M
Sbjct: 356 VLSACAAVSALQEGKRIH-DLVNRSECKSDICVGNALIDM 394


>tr|A7QB76|A7QB76_VITVI Chromosome chr4 scaffold_73, whole genome
shotgun sequence OS=Vitis vinifera GN=GSVIVT00034836001
PE=4 SV=1
Length = 492

Score = 47.0 bits (110), Expect = 5e-04
Identities = 18/54 (33%), Positives = 29/54 (53%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D + ++ CG DL KG IH +++ + ++ GN+L+ MYA CG L
Sbjct: 207 DSRTVPSILSVCGGEGDLMKGKEIHGQVVKNQIFGCEVAIGNSLIDMYAKCGCL 260


>tr|A5AEG7|A5AEG7_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_019119 PE=4 SV=1
Length = 880

Score = 47.0 bits (110), Expect = 5e-04
Identities = 18/54 (33%), Positives = 29/54 (53%)
Frame = +2

Query: 332 DRAALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
D + ++ CG DL KG IH +++ + ++ GN+L+ MYA CG L
Sbjct: 637 DSRTVPSILSVCGGEGDLMKGKEIHGQVVKNQIFGCEVAIGNSLIDMYAKCGCL 690


>tr|Q2R8W9|Q2R8W9_ORYSJ Os11g0213500 protein OS=Oryza sativa subsp.
japonica GN=Os11g0213500 PE=4 SV=1
Length = 470

Score = 46.6 bits (109), Expect = 7e-04
Identities = 21/49 (42%), Positives = 30/49 (61%)
Frame = +2

Query: 341 ALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCG 487
A+ ++ C K +L KG IH ++R +SDI GNAL++MYA CG
Sbjct: 208 AVPSVLNICAKEGELMKGREIHGRMVRCLAFDSDIAVGNALINMYAKCG 256


>tr|A5BKA9|A5BKA9_VITVI Putative uncharacterized protein OS=Vitis
vinifera GN=VITISV_005683 PE=4 SV=1
Length = 785

Score = 46.6 bits (109), Expect = 7e-04
Identities = 21/47 (44%), Positives = 31/47 (65%)
Frame = +2

Query: 353 LIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTL 493
+++ C K DL++G ++H II+ G + DI GN LLSMYA CG +
Sbjct: 318 VLRACAKLTDLSRGRKLHCYIIKLGXV-LDILLGNTLLSMYAKCGVI 363



Score = 34.3 bits (77), Expect = 3.4
Identities = 16/53 (30%), Positives = 28/53 (52%)
Frame = +2

Query: 338 AALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCGTLV 496
+ ++ ++ T G+ K L G +H +RR ++ + G LL MYA C L+
Sbjct: 211 STIVGVLPTVGEAKALGHGKALHGYCVRRSF-DNGVVVGTGLLDMYAKCQCLL 262


>tr|A2ZCL7|A2ZCL7_ORYSI Putative uncharacterized protein OS=Oryza
sativa subsp. indica GN=OsI_35522 PE=4 SV=1
Length = 470

Score = 46.6 bits (109), Expect = 7e-04
Identities = 21/49 (42%), Positives = 30/49 (61%)
Frame = +2

Query: 341 ALLHLIKTCGKRKDLNKGSRIHADIIRRGLLESDITFGNALLSMYANCG 487
A+ ++ C K +L KG IH ++R +SDI GNAL++MYA CG
Sbjct: 208 AVPSVLNICAKEGELMKGREIHGRMVRCLAFDSDIAVGNALINMYAKCG 256